Detailed information on CNT30117916


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT005738, E-value = 2e-97

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30104193Oryza nivaraOryza rufipogon59.6257.1299.02818forward

Expression of CNT30117916

Peptides detected in this lncRNA

>peptide 1 (58 aa)
RDRSCSPSRQAPAPCRSCRVSTTTGAVSTPPPLVQCRRSPPPPSPLCCCSVFCCCSVD*

>peptide 2 (88 aa)
EIDPVALAARLLRPAAPAAFLPPPAPSLRRRRWCSVAGRHHHRRRCAAAPFSAAVRWIDLQSSSSQQLGGRAGRAEKSRNWEEERQGT*

Sequence

>CNT30117916
GAGAGATCGATCCTGTAGCCCTAGCCGCCAGGCTCCTGCGCCCTGCCGCTCCTGCCGCGTTTCTACCACCACCGGCGCCGTCTCTACGCCGCCGCCGTTG
GTGCAGTGTCGCCGGTCGCCACCACCACCGTCGCCGCTGTGCTGCTGCTCCGTTTTCTGCTGCTGTTCGGTGGATTGATTTGCAGAGCAGCAGTAGCCAA
CAACTAGGGGGCAGGGCAGGAAGAGCAGAGAAGTCAAGGAATTGGGAGGAAGAGAGGCAAGGTACCTAATGACATCGATCGACATGGGGCGGGAGTAGCA
CCCTTGGACTACACATTATTATTGCACACAACTGAAATTTAGTTTTAGATTATACTTTGCTCAGCATAAGTTTTGCATAGAACTTGTAAGGGTCATTAAG
GTTCTGATTCTTATTTTTCACGTGGGATTTGTGGAACTAGGATGGTTTGGATTGTGTGGATTATATCGGTATTGACTTTTCTTATAACTGCCTGTCGTGG
ATGTCTATATTTTTAGGGGAGACTGGCGAAATTTCTAATAATTTTAGGATTAGTTTTTGAGTGTATTTTGGTATGGCATTCTAGGTACGTGGTTACCTGG
GGTGTTACAGCGTCAACCAAGAATCATGCCATGATGTGATTTCAGTTCCATTTTAATCTTCTAATTACCTGCCATGATTTTAGGTGACTGATATCTGGTT
CCCTTCTCTAGTTCTCTTGTTCTGCAGCTGCTCCTCTGGATTCTGATTCAAGGATTCTCCCGATGGAACTCTAATTTCTCCTCTTTAAACTCGGGCACCT
CCAGATTGATTTGTACTATGGCATACTAATCCTGGAACTAAAACTCCTTTCTTTACTTGAAACTCAGCTGTTGTTGCTCTTCTAAGCGGAGCCATACTAC
TCTACTACTGTTGCAACTGCTGCTAATGCTGTTCCTCGAGGTTGTCTCCCAGCCAAAACAACATGATGGCTAGTCTACTAGCTAGGCTAATATTTGTATG
TAATTTGTGAGGGCATGGTGATGCAGCTGCTTGCATGTCGGTTTGGAAAAGGATTTGCTGCCACCTCATTTTTCACCTAATCAATTTGGGGTGAAAAAGG
AAATTGGTTTTATACGTATACCTATGGAATTCTTACATTCTAGTCCTTAAGGTTTCATAATATTTAAGATTTTACTAGAGCTCGAGGGCTGATTGGTAAT
TGCTCTAGTTTTATTTTCATTTTCACAATTCCTCTATTGATTTGTATATAATAGCTATGAGTTGAGTATGTTACAGAACATTTGCAAAGCATAATATGGA
TGTATGCATGCATGCATGTATGCAGATATACACTGATCATTTGTGAATAAAGTGTCGTAACTTCTATTGTGA