Detailed information on CNT30117902


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30106047Oryza nivaraOryza longistaminata35.4518.5997.89190reverse complement

Expression of CNT30117902

Peptides detected in this lncRNA

>peptide 1 (91 aa)
STVNLKFRNVVPISSYQQELRFEKNHGNKKEHKEAEEEIYKYVIVSSNINPIQIFKYAYATNMCLITGKMVYIYPMIIKYFKGKMAFLPCG*

Sequence

>CNT30117902
TCGACAGTGAATTTGAAATTCCGAAATGTTGTCCCCATTTCAAGTTATCAACAAGAGTTGAGATTTGAGAAAAACCATGGCAACAAAAAGGAACACAAAG
AAGCAGAAGAAGAAATCTACAAATATGTTATTGTTTCCTCTAACATAAATCCTATACAAATATTTAAATATGCATATGCTACTAATATGTGTTTAATTAC
TGGTAAAATGGTATATATTTACCCAATGATAATAAAATATTTCAAGGGCAAAATGGCATTCCTTCCTTGTGGCTAGGGATGGCGAATCGCCTGAGGTTGC
CAACCTCCTCCTTGAGGTAGCCGCCGCACAGGAACGCCGTCGAGAACCTGTCCTGCACCGGCTTGTCCACGTCGTGCACCACCACGTCCGTCTCCGTCTC
CGCCGCCGGCCGCCGCGCCCGCGCCGCCACCGCCGCGGTGTATATCGCGCCCATCATCGCCGTCGTCGTCGGCGGCGGCGGCGGCGGAGAGGAGGAGGAG
GCGGCGCGGCGTGACATGGTGCTTGAGCTTGGCCTT