Detailed information on CNT30117866


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001453, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697409Oryza nivaraOryza sativa62.1684.5498.61432forward
CNT30555841Oryza nivaraOryza glaberrima202.2784.17139forward
CNT30103965Oryza nivaraOryza rufipogon55.257399.22384forward

Expression of CNT30117866

Peptides detected in this lncRNA

>peptide 1 (73 aa)
FGTLGAPTSPSSRPPPCLPYCRPGKKGRRRKGKKEAEGIEVKKEMRGFGCRCPWRPRVLKHTINPSICGMLFM*

>peptide 2 (40 aa)
LVPWGRPPPPLVDLPHACPTADLGRREEEERERRKRRELR*

Sequence

>CNT30117866
TTTGGTACCCTGGGGGCGCCCACCTCCCCCTCTAGTCGACCTCCCCCATGCCTGCCCTACTGCAGACCTGGGAAGAAGGGAAGAAGAAGAAAGGGAAAGA
AGGAAGCGGAGGGAATTGAGGTGAAGAAGGAAATGAGGGGTTTTGGTTGCCGCTGCCCATGGAGGCCTAGGGTTCTTAAGCATACCATTAACCCTTCGAT
CTGTGGCATGCTGTTCATGTGAAAACACGGCGGCCTGGGAGATCTGCTTAACTCCAGTGCAAGTCCAAGGCTAGCCTCAAGTGTATCAAGGGCGTGCCAA
CTGATTTGATCCTGCAATCAGCAAGAAAGAGAAAAGCAGAGTTAGTCAGCCGATAGTCGATCGGCCGATAGCGTATCGTTGCTGGTCTCTACCGATGGAG
TTAGACCAAATCGGCTATAGACTGGATATATTAAAGAATATTAAACCCTAAATATGCCTCATTGGTTGTAACATTGTCTATCAAGATTGATAAAGAAGCT
TAAGATAATATTATTAAAATAGCCGATGTAACAATATTTAGTGTAAGAAAGATAATATACTGGCTAATACTCTAGTACAGATCTATATAGGCAAATCAAT
CTATAGTAATATACCAAATAGAGGTCAATAGTCAATGTTGATAGCCCAGCCGATATGACCTCTACTTGATATATTACTATAAAGTGATCTGTCTA