Detailed information on CNT30117853


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30438887Oryza nivaraAegilops tauschii8.0921.749650forward

Expression of CNT30117853

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MGRAPPSPQAHNSEGGGRCSRRGGAVFRKGESVVGVCGGKGELV*

>peptide 2 (37 aa)
MQQKRWCCVQKGGECGGRLWRERRASLNGWKWGFGGCC

>peptide 3 (79 aa)
GKPFSNVNDDENHFETIYSGSKYFSATNPNTWSFLSEDQNEQVFKFISQLDDNLHVHLTHSSTLLKLLPSSSRVRLKLT*

>peptide 4 (58 aa)
QGNHSAMSTMMKTTSRQFTQVANISQPQIQTLGPSYQKIRMNRFSNSSPNSTIIYTYI*

Sequence

>CNT30117853
CAGGGAAACCATTCAGCAATGTCAACGATGATGAAAACCACTTCGAGACAATTTACTCAGGTAGCAAATATTTCTCAGCCACAAATCCAAACACTTGGTC
CTTCCTATCAGAAGATCAGAATGAACAGGTTTTCAAATTCATCTCCCAACTCGACGATAATTTACACGTACATTTAACACATTCTTCCACCCTTCTCAAA
CTCCTCCCTTCTTCTTCCCGGGTAAGATTAAAATTAACTTGAGGCCAGCCAGCGTCGCCGGCGGCGAGATGTTTACAGGCTGGGCGTCCTCTCGGCGGCG
CCGGAGATGACGGTGAGCAGGCCGTTGATGATCCGGTAGTACTCGGCGCCGCCGACGAGGACGACCTCGGCGGCGACGGCGACGATGAGGTTGATGGGGA
TGCTGTTGCCGAAGTAGTTGAGGGAGTTGAGCCGGGTGCCGAGCATCTTGGATGGGGCGAGCGCCGCCATCGCCTCAGGCCCACAATTCAGAGGGAGGTG
GGAGATGCAGCAGAAGAGGTGGTGCTGTGTTCAGAAAGGGGGAGAGTGTGGTGGGCGTTTGTGGAGGGAAAGGAGAGCTAGTTTAAATGGATGGAAATGG
GGATTTGGAGGATGTTGT