Detailed information on CNT30117820


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0IQF7|RS16_ORYSJ, E-value = 7e-96

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696918Oryza nivaraOryza sativa51.9281.1699.75405forward
CNT30515426Oryza nivaraJuglans regia26.2815.687.32205forward
CNT30391876Oryza nivaraTriticum turgidum28.7210087.95224forward
CNT3083687Oryza nivaraVigna radiata26.1521.4584.31204forward
CNT30555554Oryza nivaraOryza glaberrima89.6285.5698699forward
CNT30438780Oryza nivaraAegilops tauschii53.8552.387.86420forward
CNT30247768Oryza nivaraAvena sativa4557.7387.18351forward
CNT30663140Oryza nivaraTriticum dicoccoides44.8750.7288350forward
CNT30472632Oryza nivaraSaccharum spontaneum54.498.6992.71425forward
CNT30136796Oryza nivaraLolium perenne26.1529.8788.24204forward
CNT30721366Oryza nivaraTriticum spelta33.7251.1786.31263forward
CNT30151249Oryza nivaraBrachypodium distachyon42.0562.9690.24328forward
CNT30104226Oryza nivaraOryza rufipogon42.1868.83100329forward
CNT30581659Oryza nivaraEchinochloa crusgalli24.129.1989.89188forward
CNT30176592Oryza nivaraVigna angularis26.1525.0386.27204forward

Expression of CNT30117820

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MSMSLKRDLPASRMGSNALRRSISGLISSIGTPFTLISPRPGLQ*

>peptide 2 (36 aa)
MQNHIPETTIVLNASVASISQCQKGSGLSLKRLNLK*

Sequence

>CNT30117820
AGAACACCTAGAATAAAACTCATAACATAGCATAAACATTAATTAAGGCAATAGTATCACAACTTCCCTGGACATAGGTAACATGCAAAACCATATTCCA
GAGACTACGATAGTCTTAAACGCCTCAGTCGCATCCATTTCACAATGTCAAAAAGGTTCGGGACTAAGCTTAAAAAGACTAAACTTGAAGTAAAGCAGTA
GCTAGATGTAGAACCAGCAAAATAGCTCCATTGATAGGGTGGAAAAGAGAACACCGCTCCGAATCGATCCGGCGAGCGCTCAACGGTACGACTTCTGGAA
CCTGGCGCGGGCGCCGCGACCACCGAACTTCTTGGGCTCGCAGCGCCTGGGGTCGGCGACGAGTAGAGTGCGGTCATAGCGGGCAAAGATGTCCTTGACC
TCCTTCTTGGACGCCTCGTCGACGTACTTCTGGTAGTAGGCGACGAGGGCCTTGGCGATGGCCTGGCGGATCGCGTAGATCTGCGACGTCTTCCCTCCGC
CGCGGACGCGGATCCTCATGTCGATGTCCTTGAAGCGTGACCTCCCCGCGAGCAGGATGGGCTCGAACGCCTTGAGGCGGAGCATCTCCGGCCTGATCAG
CTCGATCGGGACGCCGTTCACCTTGATCAGCCCGCGCCCCGGCTTGCAGTAGGAGACGGCCACCGCCGTCTTCTTGCGCCCGAAGCACTGGACCGTGCCT
GGCGGCGGGCGGGTGAGCGCGGCGGCCATGGTTGCGGCGGTGGTGGCGCGCGGCGGCGGCTTGGTGCGGGAGAGAGGCGG