Detailed information on CNT30117819


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697244Oryza nivaraOryza sativa10049.09100271forward
CNT30107649Oryza nivaraOryza longistaminata98.1548.0199.62266forward

Expression of CNT30117819

Peptides detected in this lncRNA

>peptide 1 (87 aa)
ILRWGRNIVSSKTRTRKRAGIAVYNRASSLETLIGYLYLTNFKRLEQLMFQLGFTSGASSHHIADELVSSFKKKNSTSVQSQQQAAQ*

>peptide 2 (33 aa)
TYFVGEEILLAARHVPENVLELQFTIEHLHLRH*

Sequence

>CNT30117819
ACATACTTCGTTGGGGAAGAAATATTGTTAGCAGCAAGACACGTACCAGAAAACGTGCTGGAATTGCAGTTTACAATCGAGCATCTTCACTTGAGACACT
GATTGGATATCTTTACCTCACAAATTTCAAGCGCTTGGAGCAATTGATGTTCCAATTAGGATTTACAAGTGGTGCTTCCTCACATCATATTGCAGATGAG
CTGGTCTCAAGCTTTAAGAAAAAGAACTCCACTTCTGTACAATCTCAGCAACAAGCAGCGCAGTGAATAGT