Detailed information on CNT30117815


BLAST search results

BLAST vs Swiss-Prot:
sp|P85894|LTP1_MORNI, E-value = 8e-08

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524429Oryza nivaraSetaria italica64.6432.8980.27223forward
CNT30182409Oryza nivaraSecale cereale28.4131.5183.6798forward
CNT30555885Oryza nivaraOryza glaberrima66.3821.0593.45229forward
CNT3068317Oryza nivaraLeersia perrieri65.5145.289.82226forward
CNT30688859Oryza nivaraTriticum urartu28.1215.6785.5797forward
CNT30578263Oryza nivaraOryza barthii66.3822.591.7229forward

Expression of CNT30117815

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MATAACGAARSRAATRATNTNCARAMVPTTVARSIGVNWFVAD

>peptide 2 (93 aa)
MLAVARGAPVSGAAGCGLEAPHAAAAGRRRAGAAAGVGQAGPDGGVDLAAGDGHGGVRGGEEQSCHQGDQHQLCTGHGSYYCCSIDRCELVRC*

>peptide 3 (38 aa)
PGAVDGSADGVGDADAALRGDAGSCTRCACQRCCWLRP*

Sequence

>CNT30117815
CCTGGAGCAGTCGATGGAAGCGCTGATGGTGTAGGGGACGCTGACGCCGCACTTAGAGGGGATGCTGGCAGTTGCACGCGGTGCGCCTGTCAGCGGTGCT
GCTGGCTGCGGCCTTGAGGCTCCTCACGCCGCTGCAGCAGGCCGCCGACGGGCCGGCGCCGCCGCGGGCGTAGGTCAGGCAGGGCCCGACGGCGGAGTTG
ACCTGGCCGCAGGTGATGGCCACGGCGGCGTGCGGGGCGGCGAGGAGCAGAGCTGCCACCAGGGCGACCAACACCAACTGTGCACGGGCCATGGTTCCTA
CTACTGTTGCTCGATCGATCGGTGTGAATTGGTTCGTTGCTGATG