Detailed information on CNT30117665


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30371172Oryza nivaraOryza glumipatula35.1950.2490.43209forward
CNT30109239Oryza nivaraOryza longistaminata35.1938.5692.82209forward
CNT30577809Oryza nivaraOryza barthii26.4318.7895.54157forward

Expression of CNT30117665

Peptides detected in this lncRNA

>peptide 1 (71 aa)
LHELNFILTHIDRSISHSHTLLSHLTTFIILHQQADLEINHARTKRINQAMKSNKKASVDIDGMDELKIQL*

>peptide 2 (50 aa)
CTNLILFSHTSIDRSHTVTLSSHISQLLLFCTNKLTWKLIMQEPKGLTKP*

>peptide 3 (49 aa)
MAAARSWTAPARGTARCSPRCAAARSSRRRRGGRRRRPCSRTRRRCSCT*

>peptide 4 (33 aa)
MPAGGLGAGAAAPPPFAAPPPFAGVGLGPWGLL*

Sequence

>CNT30117665
CTGCACGAACTTAATTTTATTCTCACACACATCGATCGATCGATCTCACACAGTCACACTCTCCTCTCACATCTCACAACTTTTATTATTCTGCACCAAC
AAGCTGACCTGGAAATTAATCATGCAAGAACCAAAAGGATTAACCAAGCCATGAAATCAAACAAAAAAGCAAGTGTGGATATTGATGGAATGGATGAATT
AAAAATTCAGCTGTGATATGCCGGCCGGAGGGCTGGGAGCCGGCGCCGCAGCTCCGCCACCGTTTGCCGCGCCACCACCGTTCGCCGGCGTCGGCTTGGG
GCCTTGGGGTCTGTTGTAGAAATAGTCGAAGAAGGGGCACAGGAACGCCGAGGTGCACTCCGCCGACGACGAGTAGTGCATCCTCTTGCCGGCGACGGCG
ACGAAGGTGTTAGCCTTATTGCCGCCGTTGTCCGTCGTTGATGGCAGCGGCACGATCTTGGACGGCTCCTGCCCGGGGCACGGCGCGCTGCTCGCCGCGC
TGTGCAGCTGCGCGAAGCAGCCGGCGGCGCCGTGGAGGTCGTCGCCGACGGCCTTGCTCTCGTACTCGCCGTCGCTGTTCTTGCACTTGATCGC