Detailed information on CNT30117593


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT007533, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30370125Oryza nivaraOryza glumipatula22.5264.8496.89225forward
CNT30578376Oryza nivaraOryza barthii25.4339.5694.88254forward

Expression of CNT30117593

Peptides detected in this lncRNA

>peptide 1 (98 aa)
VAVDFPSKSGLLSRVISKLVEGKYSSISPLLFPQESNFIPKKSTRNRARFVFISPPNPRIFRLKSFRLESDLPHPCLYKGSPSRPLPFASSQSRSRRP*

>peptide 2 (54 aa)
MMDLYIKLSVCVPRLIPGRGFYAQISSEITSEFPGVTLSNIYSFSAAYLAWCGL*

Sequence

>CNT30117593
CAGTTGCCGTCGATTTCCCCTCCAAATCCGGTCTCCTCTCTCGTGTTATTTCAAAATTAGTTGAGGGGAAATATTCCTCTATATCTCCTCTACTTTTCCC
CCAAGAATCGAACTTTATCCCGAAGAAATCAACGCGGAATCGAGCTCGGTTCGTGTTTATCTCTCCACCTAACCCTCGGATTTTCCGGCTCAAATCCTTT
CGTTTGGAGTCCGATCTCCCTCACCCATGCCTATATAAAGGATCCCCTAGCCGCCCTCTTCCGTTTGCGTCGAGTCAAAGCCGCAGCCGTCGCCCGTAGC
GCCGCCACCGCGTAGCCCTAGTCGTCGCCGTCATTGTCGTCGCTTCAGCCGCGCGCGCGCCGCTGCTGTGGTCGTCGCCGCCGCCTTACGTCGCCACCGT
CGGGTTCGTGAGGAGGAGGAGCACCCCGTCCGCCCCTTTGCAGCCGCCGAAGACCGCCGGAGCGCCGCCGTTGACGTTGAGCCGAACCGTGCCGCCTTGG
GACCTCGTTGCCGGCCGTCGTTTGTCGTCGTCCGTCGTTTTTCTTTGCACCGCTCGTCGTTTCCGTTGTTGCGAAGTTTCGCGAGTGCGTCGAAACTAGT
TTAGAAGACTATTTGAAGACCGATTATTGCAAGAGAAAGGATCCAGAAGGAGAAGACGTTTGGCTTATACCCCAGTTGAGCTGCCTGTGGGAGTGGAGCT
GAATCCATCGCTAGACCGTTAATCCGTTGTTGTTTTTCTTTTCTTTTGTAAGTATGCAACGTTATTATTATGATGGATTTGTATATTAAATTGTCAGTTT
GTGTACCTCGGCTGATTCCCGGACGAGGATTTTATGCACAAATTAGTTCAGAAATTACTAGTGAATTTCCGGGCGTGACACTATCCAACATTTATTCTTT
CAGTGCCGCTTATCTTGCTTGGTGTGGTCTGTAATTCATTTGGCTTCTAATCTGAAACCTCCTCGCAATGTTGGTCATACGTTTGGGAGTTGGCTATCA