Detailed information on CNT30117559


BLAST search results

BLAST vs Swiss-Prot:
sp|P12330|CB21_ORYSJ, E-value = 2e-154

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696263Oryza nivaraOryza sativa92.4890.1999.49984forward
CNT30188246Oryza nivaraSecale cereale53.8554.1190.23573forward
CNT30285424Oryza nivaraTriticum aestivum45.3967.8493.17483forward
CNT30394891Oryza nivaraTriticum turgidum47.9356.2990.59510forward
CNT30684601Oryza nivaraTriticum urartu52.0757.6589.53554forward
CNT30345520Oryza nivaraEragrostis tef47.9359.2392.35510forward
CNT30370987Oryza nivaraOryza glumipatula62.596.2499.1665forward
CNT30582453Oryza nivaraEchinochloa crusgalli57.4257.6491.16611forward

Expression of CNT30117559

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MAWTKKPNMENMARRPFLISFTLSSANASGSSARPSGSKAPPG*

>peptide 2 (31 aa)
MRYPSTAPMSTTCTAQMARMLCAWIRLGLPR*

Sequence

>CNT30117559
AGTATTTGTTTCCGATCTAATAGAGATGAGAAATCCGCTAATCAAAATAACACCACGGATAAGTACCTAGACCATTAGTTGGGAAACGAATAAAATCATT
ATTGCAAAAACATCATCTTCTTCTTCATCTTCTTAGTGTACACAACACCAACTCGATCATCATCTCGTCGCACTAAACCCATCTTCCCCAACCCAAAGAC
AACGAACTCGCTGGCCACAAATCCATCCAACCACAATTAACCACTGCTAAGCTACGGTCCCCCACTTCACTTGCCGGGGACGAAGTTGGTGGCGTACGCC
CAGGCGTTGTTGTTGACGGGGTTCTCGAGGGGGCCCTTGCCGGTGACGATGGCCTGGACGAAGAAGCCGAACATGGAGAACATGGCGAGGCGGCCGTTCT
TGATCTCCTTCACCTTGAGCTCCGCGAACGCCTCGGGGTCATCGGCGAGGCCGAGCGGGTCGAAGGCGCCGCCGGGGTAGAGCGGGTCGACGACCTCGCC
GAGCGGCCCGCCGGCGATGCGGTACCCCTCGACGGCGCCCATGAGCACCACCTGCACCGCCCAGATGGCGAGGATGCTCTGCGCGTGGATCAGGCTCGGG
TTGCCGAGGTAGTCGAGCCCGCCCTCGCTGAAGATCTGCGAGCCCGCCTTGAACCACACGGCCTCGCCGAACTTGACGCCGTTCCGGGCGAGGAGCTCCG
GGAAGACGCAACCGAGCGCGCCCAGCATCGCCCACCGGGAGTGGATCACCTCCAGCTCCCGGTTCTTGGCGAACGTCTCCGGGTCGGCGGAGAGCCCCGC
GGTGTCCCACCCGTAGTCGCCCGGGAACTCGCCGGTGAGGTAGCTCGGCGGCTCGCCGGAGAGCGGGCCGAGGTAGAGGACGCGGTCGGCGCCGTACCAC
GGGCTCCCCGACGACGCCGCCGGCTTGGGCTTCGCGGCGGTCTTGCGCATGGTGATCCGCGCCTCGCCGAAGAGCGCGGAGGAGAGCGCCATGGTGGCCG
CGGCCATTGATGCAGTGAGCTGTGAGAGCTGAGAGAGATGGCGATGAGCGAGCGAGTGTGAGTT