Detailed information on CNT30117489


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000299, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30596733Oryza nivaraOryza meridionalis47.6199.0693.56528forward

Expression of CNT30117489

Peptides detected in this lncRNA

>peptide 1 (98 aa)
MVGLHTGKRDGHAQRQHLHHQRDIATSSRITYEVHDNDLARVESKLPGFDGKYDSAAYVNWELAVEKQFDEYDFSNAQMIKAASMYRFCIFLVAYCGK*

Sequence

>CNT30117489
CCATTTTTGTATAGTTCTAATTTTGGGTTTGAACTTTTACATTTGAGTCCCTGTGATTTTTGTATTTACGTTTGAGTCCCTGTAATCTTACATTGAGGTC
CTTGAATCTATTTTTGTAAAATAAAATAAAAAAAAGAAAGAAAAAAAAGGCAGAAAGGTGCAAAAAAAAAAGAGAAAAGAAAAGCCGCACAAAAAAAAAG
AAAAGAAAAGGAAAGGAAAGAAAAAAAAAAGAGAAAGAAGAAAGAAAGAAAAGAGAAAATATTGTTATGTTTGAGCTGAACTTCATATATCAGAGTTGTG
CATGAGTTGTTCCTAGTGCTATCTTGTGGTATCATTTTTGTCTAGGCTCGCGTCTCTAGTACGTTCTAGCCTAGGACCAGCACGGTACTTGACTTTGAAC
CATTATTCAACTTTGTATTCTCTGATTTGAGCATTTGCTATCCCTTTGCTACATATTTAAGCCTACCCAGAGCTCCACAGGTCTGATTGCAGCCATACAG
CAAGTGTTTGCCAAGGCATCGATACATCCAACCTCCATTTGGGTGCTTGGTTAAGTCAGTGTACATTACCATTCCGCTTGCATTGGTAAGATCTTGTAAG
AGCTTGGTTAAAAGCTTGAGTGTGTGTGATTTTTGAGCTGCCACTACCTAGTAGTTAATAGGAACGCACATATTTTTGTGTATGTTTCTTGTTTGCTACT
AACCATGGTAGGATTGCACACGGGGAAACGAGATGGTCATGCTCAACGTCAACATCTTCACCATCAACGAGATATAGCGACTTCTTCACGCATCACATAT
GAGGTACATGATAATGATCTTGCAAGGGTAGAATCTAAATTGCCTGGTTTTGATGGTAAGTATGATTCCGCCGCTTATGTTAATTGGGAGCTAGCAGTAG
AAAAACAATTTGATGAGTATGATTTTTCTAATGCTCAAATGATTAAGGCTGCTAGTATGTACCGGTTCTGCATCTTTTTGGTGGCATACTGTGGGAAATA
AACTTGAAACTTGGGATGAATGCAAAATACTGATGAGAAAAAGATTTGTGTTTTCATACTATAGACGTGCTCTCCTTGAGAAATTTGAACATCTAAAACA
AGGTGACAA