Detailed information on CNT30117400


BLAST search results

BLAST vs Swiss-Prot:
sp|Q0J8M2|FER1_ORYSJ, E-value = 7e-45

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675769Oryza nivaraSetaria viridis24.6834.4191.12214forward
CNT30307945Oryza nivaraTriticum aestivum24.5733.690.61213forward
CNT30398830Oryza nivaraTriticum turgidum24.5729.590.14213forward
CNT30670012Oryza nivaraTriticum dicoccoides24.4531.2290.09212forward
CNT3011815Oryza nivaraZea mays25.3726.2888.18220forward
CNT30683972Oryza nivaraTriticum urartu24.5730.9190.14213forward
CNT30584428Oryza nivaraEchinochloa crusgalli24.5720.4692.49213forward

Expression of CNT30117400

Peptides detected in this lncRNA

>peptide 1 (84 aa)
AILMGLILTSIGIYTSIHTRTVNSVRNTWSRHKSRTRIYSLLINCSFKYMEYVFDSSIYDTVMHAYMTPKCDMDMIKQVQQNVH*

>peptide 2 (61 aa)
MYTSSGTCSSTSPSGVISFTLYVACIRSLSPSLLLAGSTDTRAGTSATGPGCSVPSPPWLL*

Sequence

>CNT30117400
GCGATTTTAATGGGATTAATTTTGACCTCGATCGGCATATATACATCCATTCATACACGAACAGTTAATTCAGTACGAAACACATGGAGTAGACACAAGA
GTAGAACTAGGATATATAGCTTATTAATTAACTGTTCTTTCAAATACATGGAGTACGTATTTGACAGTAGTATATATGACACAGTAATGCATGCATATAT
GACACCAAAATGTGATATGGATATGATTAAGCAGGTGCAGCAAAACGTACATTAATTAAACAACAACAATTAACCCTCGGGCACGCCTGTGTTTTGTTAT
CTCGCTCAACGTATACGTACGTAATACTTTGCTTGCATAGCATAGGGACGACGACATTATATTCTTAATTGATAAACTCAAGAACGCATGGAGATGGATT
GAGAGATTTATAAATATGGAGCTTGCTTGATTGATTAGATGAGGTCGTCCTCCTTGTGGGTCTCGATGACGACGTCGGACTTGGGGTAGGCGTGGCAGGT
GAGGACCCAGCCGGCGGCAACCTGGTCGTCGTCGAGGAAGCTCTGGTCGGACTGGTCGATCCCTTCCTCCTCCGCCTGGTCCAGGATGTACACGTCGTCC
GGCACCTGCAGCTCCACCTCGCCGTCCGGTGTGATCAGCTTCACGTTGTACGTCGCCTGCATCCGCAGCCTGTCTCCCAGCTTGTTGCTCGCCGGCAGCA
CCGACACGCGCGCCGGGACATCGGCAACCGGACCTGGCTGCTCAGTGCCGTCGCCGCCATGGCTGCTATAGCTAATTAAGCTAGCTAGCTGCTGCTGCTA
GGTAAGGTAGACGAGGAGGAGAGGAGTGAGCTAGCAAGAATGTGAGCGTGAGGTTGAAGGAGGCTGA