Detailed information on CNT30117266


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695011Oryza nivaraOryza sativa38.554.94100139forward
CNT30672141Oryza nivaraSetaria viridis36.0118.3996.15130forward
CNT30520455Oryza nivaraSetaria italica38.526.1396.4139forward
CNT30288773Oryza nivaraTriticum aestivum20.2227.8695.8973forward
CNT30221764Oryza nivaraHordeum vulgare36.5746.3295.45132forward
CNT30386161Oryza nivaraTriticum turgidum51.2530.4391.35185forward
CNT30436586Oryza nivaraAegilops tauschii38.560.4397.12139forward
CNT30252645Oryza nivaraAvena sativa48.4868.0996175forward
CNT30659042Oryza nivaraTriticum dicoccoides38.547.4497.12139forward
CNT30132533Oryza nivaraLolium perenne38.7856.4595140forward
CNT3013862Oryza nivaraZea mays30.1915.6294.5109forward
CNT30680070Oryza nivaraTriticum urartu48.7530.9394.89176forward
CNT30370710Oryza nivaraOryza glumipatula34.6331.6598.4125forward
CNT3053136Oryza nivaraAmborella trichopoda37.1230.4582.84134forward
CNT3038710Oryza nivaraCucumis melo35.4640.2581.25128forward
CNT30581231Oryza nivaraEchinochloa crusgalli48.7581.4895.45176forward
CNT30556637Oryza nivaraPanicum hallii37.1261.1996.27134forward

Expression of CNT30117266

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MGEEGGGVGEVLLLAGGVPRRRVEDADLGQELRDEDARRAQHRPPAVH

>peptide 2 (56 aa)
MVAWPGSARWAKRVVVSVKYCCSPAVYHDGVLRMPILVRNSGMKMPAAPSIAHRQCT

Sequence

>CNT30117266
GAGATATTCAGGTTGCAGGAGAGGTGCGTATAGGAAACTGAAACTCTTTCAATCACTCGGGTGAACGTCCACTCGTTTATTACACGTCAACTAAATGGTT
ATAAAAAATTTTAACAAGATAAACTGTTATAAAAAATTTTAACAAGATAAACTAATATGCAATAGTGTTTATGGACTACGGACCTGGAAGATGGTGGCGT
GGCCGGGGTCGGCGAGATGGGCGAAGAGGGTGGTGGTGTCGGTGAAGTATTGCTGCTCGCCGGCGGTGTACCACGACGGCGTGTTGAGGATGCCGATCTT
GGTCAGGAACTCCGGGATGAAGATGCCCGCCGCGCCCAGCATCGCCCACCGGCAGTGCACC