Detailed information on CNT30117149


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006857, E-value = 1e-170

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30117149

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MIYMLKISTCTVYACFCIVYLVFISLFLRFAC*

>peptide 2 (57 aa)
AAARPRRRPSSFVVWFEGEYRWVRLVVLYMFMSSKVAADHPISGEVAILVRPLMRSS*

>peptide 3 (52 aa)
PPLDLVVGRRRSSFGSRVSTVGFVSSSSTCSCPPKSQPTIQSPARSPSWSGH*

>peptide 4 (78 aa)
MLVFVLFIWFLLVFFFVLRVNLSFPSLRRFVSASGVFRRLIEDRLLQVEEKGSRRRRRLAYTPVELPVGVELKPSLDR*

Sequence

>CNT30117149
CGCCGCCGCTAGACCTCGTCGTCGGCCGTCGTCGTTCGTCGTTTGGTTCGAGGGTGAGTACCGTTGGGTTCGTCTCGTCGTCCTCTACATGTTCATGTCC
TCCAAAGTCGCAGCCGACCATCCAATCTCCGGCGAGGTCGCCATCTTGGTCCGGCCATTGATGAGGTCATCATGACGTCATCATCGTTTTTCTTTTTCCT
GTTTTTCTAATAGATTAAATCTTCAGAAATTCATAACTAAATCATCGTAACTCGGTTTTGAGTGGTTCAAGTTGCTAAATTCATCTAAACTCATGATCTA
CATGTTAAAAATATCCACATGTACTGTTTATGCTTGTTTTTGTATTGTTTATTTGGTTTTTATTAGTCTTTTTCTTCGTTTTGCGTGTTAACTTGTCGTT
TCCGTCGTTGCGAAGGTTCGTGAGTGCGTCGGGAGTGTTCAGAAGATTAATTGAAGACCGATTATTGCAAGTTGAAGAAAAAGGATCCAGAAGGAGAAGA
CGTTTGGCTTATACCCCAGTTGAGCTGCCTGTGGGAGTGGAGCTGAAGCCATCGCTAGACCGTTAATTCCACTGCTGTTTTTTTTT