Detailed information on CNT30117074


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6Z2T6|CHLP_ORYSJ, E-value = 7e-84

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30173457Oryza nivaraTrifolium pratense7.3723.9481.51119forward
CNT30228703Oryza nivaraAnanas comosus7.3141.2688.14118forward
CNT30357885Oryza nivaraLactuca sativa12.6420.184.31204forward
CNT30573804Oryza nivaraVitis vinifera16.4850.2880.83266forward

Expression of CNT30117074

Peptides detected in this lncRNA

>peptide 1 (90 aa)
MNHAETWSLYSSTLSSHRRLVCFSNPTKLPPSLNITLCCTRKSDRVDRYTASLSYPSLLTLVQICLISRESVLYMHTDPPQIAVSNASRK*

>peptide 2 (33 aa)
MSLATRELAPSAPTIASTSNVRFSPPALPLELS*

>peptide 3 (30 aa)
MPMYSCGASVPPMSTATLDGEIIFIFLTFLS

>peptide 4 (60 aa)
MPQENEAKCSIAVVVMAAQAHKVTFSISRRVAAWNFLMSGLWVTVPVPTATWSHLGNTQP*

>peptide 5 (46 aa)
MYIFVQVLYNFVHHRAKLVFSAHKGSEQSEIQHDGRSFYSQNSQCM*

Sequence

>CNT30117074
TTGCATGAAGAACAGCTAAAGTAAACCATTTCATGTCATTCACCATTCGTCAGGAAACATGAACCATGCAGAAACATGGAGCTTATATAGTAGTACATTG
AGTTCACACCGAAGATTGGTGTGCTTCAGTAATCCAACCAAACTGCCCCCAAGTCTGAACATCACCTTGTGTTGTACAAGAAAATCGGACAGGGTCGATC
GGTACACAGCCTCTCTCTCTTATCCATCTCTACTTACGCTTGTTCAAATCTGTTTGATCAGCCGCGAATCTGTACTATACATGCACACTGATCCACCGCA
AATTGCAGTTTCTAATGCCTCAAGAAAATGAAGCAAAGTGTTCGATCGCGGTCGTGGTCATGGCAGCTCAGGCTCACAAGGTGACCTTCTCCATCTCGCG
GCGGGTGGCGGCCTGGAACTTCTTGATGTCGGGCTTGTGGGTGACGGTGCCGGTGCCGACGGCGACGTGGTCGCACTTGGGGAACACCCAGCCGTAGAAG
TCCGGCGAGACGTCGTCGCCGACGTACATCTCGGCGCGCTCCTCGTAGTACTTCATCTTGTCGTCGGGGATCTTGACGCGCTCCTGGAACGCGATGGCGT
ACTCGTAGTCGCCGGCGCCCATGTCCTTGGCGACGCGGGAGTTGGCGCCGTCCGCGCCCACGATCGCGTCCACCTCGAACGTCCGCTTCTCGCCGCCGGC
CTTGCCGTTGGAGCTGTCGTAGTGGTTGTAGTGCACCACGTACGACCCGTTGGGTTCCTTGGGCGCCTCATACCTTTCAAACAACAGAGACGACATGATC
CAAAAACATGTTTATTTTCCCCAATAAACTTGTAATAGTGTTAATGCACAGGGCAGCATAAATCAAGTAAAAATGTTGCAATCACACCGAATGGGCCTAG
TTTAGAACATGGAGGTATTTCTTTATACATGTGGTGCTGAATTATGTTTCAATGAAATTTTTGCTGGACTTTACGGAAATCAATAGTTAGAATCTTGCAA
CATATCCAAACATCAAGCCATTATCATTTTTTTTCATTATTTCAACATGCACGTACAAATTAGTATTGCTTTTTTACAGGTATTAGAAAATTGGGGTTTC
CACGCAGATAGACTGTTCCTAAGATAAATTTGCAACAAATATTCATGCTATTTTACGGTTGCTAGAATTCAGGGTGGTTCTACAAACATGCACAAATCTT
CTGAACAGTACTAGAAATTTTGGGTTTTGCACACATGCACACAGATCAGCTCTTGGTGAGGCAGTAGTAATAAACAAACATGTACATTTTCGTGCAGGTA
CTATATAATTTTGTTCATCATCGTGCAAAATTAGTGTTCAGTGCGCACAAAGGTTCAGAGCAATCAGAAATCCAACACGATGGCAGAAGTTTTTACTCAC
AAAATTCACAATGCATGTGACTGAGTTAGCAATATACCTCAGGAAGAGACCATTGACGACCTCGGCGCCGGCCCCCTCGGCGCGGGAGCGGAGGTAGGCG
TCGAGCACCTCGCGGCGGACCATGCCGATGTACTCGTGCGGCGCGAGCGTGCCGCCGATGTCGACGGCGACGTTGGACGGCGAAATCATCTTCATCTTCC
TCACCTTCCTGTCG