Detailed information on CNT30117026


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONBNAT004015, E-value = 2e-25

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30675224Oryza nivaraSetaria viridis37.3530.293.23251forward
CNT30522713Oryza nivaraSetaria italica28.5751.7592.19192forward
CNT30534291Oryza nivaraEucalyptus grandis33.3335.1680.36224forward
CNT30516889Oryza nivaraJuglans regia35.8639.8381.74241forward
CNT30377201Oryza nivaraArabidopsis thaliana19.9423.4385.07134forward
CNT30617295Oryza nivaraSesamum indicum25.641.9583.14172forward
CNT30728063Oryza nivaraCorchorus capsularis20.0915.5585.19135forward
CNT30381383Oryza nivaraManihot esculenta27.3810.4783.7184forward
CNT30402401Oryza nivaraBeta vulgaris20.2411.4590.44136forward
CNT30629386Oryza nivaraVigna unguiculata21.2855.4383.92143forward
CNT30196370Oryza nivaraPisum sativum22.6215.9587.5152forward
CNT30486254Oryza nivaraOlea europaea19.7934.7387.97133forward
CNT30708222Oryza nivaraGlycine max19.793386.47133forward
CNT30168132Oryza nivaraPistacia vera17.7128.9583.19119forward
CNT3092760Oryza nivaraSolanum tuberosum34.9733.9680235forward
CNT30291318Oryza nivaraTriticum aestivum15.7731.8394.34106forward
CNT30223001Oryza nivaraHordeum vulgare13.3932.3795.5690forward
CNT30562825Oryza nivaraActinidia chinensis34.8242.3983.76234forward
CNT30542792Oryza nivaraBrassica napus19.0529.4986.72128forward
CNT30511260Oryza nivaraSolanum lycopersicum14.7324.5787.8899forward
CNT30442409Oryza nivaraAegilops tauschii36.937.0183.87248forward
CNT30252641Oryza nivaraAvena sativa23.3619.3189.17157forward
CNT30261872Oryza nivaraBrassica rapa33.1825.282.96223forward
CNT30614070Oryza nivaraArabis alpina20.249.8491.18136forward
CNT305432Oryza nivaraZea mays18.934.691.34127forward
CNT30608822Oryza nivaraGossypium raimondii19.942085.82134forward
CNT30681848Oryza nivaraTriticum urartu35.7127.1290240forward
CNT30722532Oryza nivaraTriticum spelta36.936.0583.87248forward
CNT30341625Oryza nivaraEragrostis tef36.0124.8285.12242forward
CNT30364844Oryza nivaraSorghum bicolor18.628.6791.2125forward
CNT30595589Oryza nivaraOryza meridionalis15.7723.2598.11106forward
CNT30369350Oryza nivaraOryza glumipatula38.6937.4197.69260forward
CNT30422340Oryza nivaraPapaver somniferum33.7826.880.18227forward
CNT30570854Oryza nivaraVitis vinifera6.722.3995.5645forward
CNT30706519Oryza nivaraPrunus avium35.8629.0783.4241forward
CNT3033661Oryza nivaraTheobroma cacao18.0158.1785.95121forward
CNT3024558Oryza nivaraPopulus trichocarpa37.513.8184.92252forward
CNT30328090Oryza nivaraAsparagus officinalis35.1269.8285.17236forward
CNT30332119Oryza nivaraDioscorea rotundata35.4237.4884.45238forward
CNT30149545Oryza nivaraBrachypodium distachyon13.126.1989.7788forward
CNT3099978Oryza nivaraOryza rufipogon41.0734.0786.59276forward
CNT30575061Oryza nivaraOryza barthii40.4829.9299.63272forward
CNT30333708Oryza nivaraCynara cardunculus35.1229.1483.9236forward

Expression of CNT30117026

Peptides detected in this lncRNA

>peptide 1 (59 aa)
LVLALLIGGGILVLLVLRDKVVHVALCLGELHLVDAMERPLGGMSQTLDFTLLGIHSTK*

>peptide 2 (54 aa)
MFLASHICCVSSGTVRARYCWEPRDVSGANPTMKKWRRGKGIRFTASLRRSEFN*

>peptide 3 (47 aa)
MVQIPNCIKWQTCGKCYMAQWLKIMRVYVDNKNITCPNKQQYDKANH*

>peptide 4 (29 aa)
PRTRPPHRRWHPGTAGTQRQGRSCCSLPR*

>peptide 5 (67 aa)
SYSPSSSAVASWYCWYSETRSFMLLSASVNSISSMPWRGLSVECHRHWTSHCWGSTRRSRMSSCSGH*

Sequence

>CNT30117026
CCTCGTACTCGCCCTCCTCATCGGCGGTGGCATCCTGGTACTGCTGGTACTCAGAGACAAGGTCGTTCATGTTGCTCTCTGCCTCGGTGAACTCCATCTC
GTCGATGCCATGGAGAGGCCTCTCGGTGGAATGTCACAGACACTGGACTTCACATTGTTGGGGATCCACTCGACGAAGTAGGATGAGTTCTTGTTCTGGA
CATTGATCATCTGCTCATCAACCTCCTTGGTGCTCATCTTTCCACGGAACATGGCAGAGGATCAGCAGCGCACATCATGTTCTTGGCATCCCACATCTGC
TGTGTGAGCTCAGGAACAGTAAGGGCACGGTACTGCTGGGAGCCACGTGATGTCAGCGGGGCGAATCCGACCATGAAGAAGTGGAGACGGGGAAAGGGGA
TAAGGTTCACTGCCAGCTTACGGAGGTCAGAGTTCAACTGACCAGGGAACCTTAGGCAGCATGTGACTCCACTCATGGTGGCAGAAATCAAATGGTTCAA
ATCCCCAACTGCATAAAATGGCAAACATGTGGAAAATGTTATATGGCGCAATGGTTGAAAATTATGCGGGTATATGTTGATAACAAAAATATAACATGTC
CAAACAAACAACAATATGACAAAGCAAATCACTAACTGGAGTCAACGCCTTTATGTTTAGCATGAATCCTGC