Detailed information on CNT30116895


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000920, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694227Oryza nivaraOryza sativa55.327799.232210forward
CNT30302628Oryza nivaraTriticum aestivum2.1527.3983.7286reverse complement
CNT30553992Oryza nivaraOryza glaberrima23.48100.1199.57938forward
CNT30667599Oryza nivaraTriticum dicoccoides2.1528.8683.7286reverse complement
CNT3067041Oryza nivaraLeersia perrieri8.0120.2782.5320reverse complement
CNT30105326Oryza nivaraOryza longistaminata87.9679.6197.813514forward
CNT30102228Oryza nivaraOryza rufipogon86.4383.9799.573453reverse complement
CNT30576862Oryza nivaraOryza barthii33.2760.7198.651329forward

Expression of CNT30116895

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MVENKGNVLEWLRLTTVNSKQLQMPLVLATCNYSLHPCVHEQMSRIIHYSMY*

>peptide 2 (41 aa)
MPNDLQRAAKSSQPFKKLKITTWHFLTFKVVFESPEDEGCV*

>peptide 3 (39 aa)
MVGTSNLHESFLFEVCQENKTMRCVCIISVNTNTENKRN*

>peptide 4 (37 aa)
MCKCEFSGIHERQNEIYESRQLGSIQVQPGKLKTAFG*

>peptide 5 (36 aa)
MAQINLNGNSNSSECPWFRQHVSTPSVHFVHEQNDE*

>peptide 6 (34 aa)
MSCSKICLEHITKEPRRCRMISNGQQNHHSHSRN*

>peptide 7 (45 aa)
MHPLEISIENSNGWYLQWVNPFCSKSSQENKMMQHVCANSVEYRK*

>peptide 8 (50 aa)
MKRKRNCSQCEEYKCLRNTTASSTFIGLSFAFDQSNNPTPTIPYHQTYQF*

>peptide 9 (48 aa)
MVENKENVLEWLRLTQTVNSQQLQMPTVLATRTYYLRPSVHEQMSRII*

>peptide 10 (42 aa)
MLISAKVDRHRPLCSLRTIRSTLPQIQHMLMRSPTLRASIIV*

>peptide 11 (55 aa)
MPLDWVSATCKCKFSGINESKNVFYESEKISSIQLLASQQTEKYQTWIYTDTIQP*

>peptide 12 (30 aa)
MGIRTLRPLGGLIVGKLWEGIPAKPLLTMA*

>peptide 13 (30 aa)
MISNGQPNHHSHSRNKKITNNEICIHRSML*

>peptide 14 (31 aa)
MAQVNPNCQFPTVTNAHGSGNTYILPPSLST*

Sequence

>CNT30116895
CCGGTTGTTGGGAGAAGACAACAACAATAAAACAAAACAAGAAAAAAAGTGCTGGTAAAGGCCGAAGATAAATAATACATAAAAGGAAGGCTTATTTTGT
TCTTTGGAACTATGTATATACAAGATGGTGGCCTTGTTTGTAACCTGTCTAAGTAGGGAAATCAGCACAGACATGTGACAATGCTCAACGCATTTTATCC
CGTGATAATTATTATTTGAGGATTCAGATGGTTGGTACCTCCAATTTGCATGAATCCTTTCTGTTCGAAGTCTGCCAGGAAAACAAAACAATGCGATGTG
TATGTATAATAAGCGTCAATACAAATACAGAGAATAAAAGAAACTAAAACTTGCAAACTATCAAAATAAGAGGGGAGATTTTTGCCTTTCGCCACGGACT
TGTTACATCATCTCATACATGCCACTTGATTGGGTCAGCGCAACATGTAAGTGCAAATTCAGTGGCATAAATGAAAGTAAAAATGTGTTTTATGAATCCG
AAAAAATCAGTTCTATACAATTATTAGCTTCTCAGCAAACAGAAAAATACCAGACATGGATCTATACAGATACAATACAACCATAAGAAAACTAAGGACT
GTTTTGGGCAAAACATGGTTGAAAACAAAGAAAATGTACTAGAATGGCTCAGGTTAACCCAAACTGTCAATTCCCAACAGTTACAAATGCCCACGGTTCT
GGCAACACGTACATACTACCTCCGTCCCTCAGTACATGAACAAATGAGTAGAATCATTTAACATGTACTAACAAGAAATAGCTGCAACCGGTAACTTGCT
GGGGAGCAAGGCCTCCTAGTATGACAGCCGATTGAACATATTACCAAGGAACCAAGGAGATGCCAAATGATCTCCAAGGGGCAGTCAAATCATCACAGCC
ACCAGTTCCAAATGCCTGTGTGGTTACAACCGTAAGAAACTAAGGACTGTTTTGAGTAAAACATGGTTGAAAACAAAGGAAATGTACTTGAATGGCTCAG
ATTAACAACTGTCAATTCCAAACAGTTACAAATGCCCTTGGTTCTGGCAACATGTAACTACTCCCTCCATCCCTGTGTACATGAACAAATGAGTAGAATC
ATTCATTATAGCATGTACTGACAAGAAATAGCTGCAACTGGTAACTTGCTGGGGAGCAAGGCCTCCTAGCATGACAGCTAATTGAACATATTACCAAGGA
ACCGAGAAGATGCCAAATGATCTCCAATGGGCAGCCAAATCATCATAGCCATTCAAGAAATAAAAAAATAACAAACAATGAAATATGCATCCACAGAAGT
ATGCTGTGAAAGTATGAAACAACAAAAAGAAAGATCACGCTAAAGCTAACTGAATAAACAGTTAACATTCCTTTATTAGTGTTACATTACTTAATTTTAG
AAAAAAGAAACAATTAAGCTCCTATGAGCAAGTATTGTCATCACCGTGCAGTAAGCAAGTTAGACTACAAGTATTGCCCATGATGGTACCATAACATCCC
CCCATTTATGATTTATTCATTCTGGGAAGACTTCGTGCTCATTAAAGTGCCTGCTGGTAAAAAAGTAAGAACTAAAATACCATTGAGCTGATTACCAACA
GGATATTGCAATGGGTAAAAAGTAGCAAACTGCCATCGCGAGACATGCTTGCTAATTTGCCAGAGCACTGTAAAATGTCGGTTGTGGGAGAAGATAACAC
GAATAAAACAAAAGGAAATAAGTTGCGCTGAAGTGCTGATAAAGACTGAAGATAAATAATACACAAAGACGACTATTTTTTGGTCGGTAGGGATATCAGC
ACAGGCATGTGACAATGCTCAATGCACCCATTGGAAATTAGTATTGAGAATTCAAACGGTTGGTACCTCCAATGGGTGAATCCTTTCTGCTCTAAATCTA
GCCAGGAAAACAAAATGATGCAACACGTTTGTGCAAATTCCGTGGAATACAGAAAATAAAATAAATTTACAAACTCAAATATCAAAACAAGAGGGGAGAT
TTTTTGCCTTTCGCCACTGGATAAGATCAAGGCAATGTGCAAGTGCGAATTCAGTGGCATACATGAAAGGCAAAATGAGATTTATGAATCCAGACAACTC
GGATCCATACAAGTACAACCAGGAAAACTAAAGACTGCTTTTGGGTAAAATAATGATTGAAAAGAAAAGAAATATATTTGAATGGCTCAGATTAACCTAA
ATGGCAATTCCAACAGTTCTGAATGCCCGTGGTTCCGGCAACATGTAAGTACTCCCTCCGTCCACTTTGTACATGAACAAAATGATGAGTAGAATCATTC
GTTATAGCATGTACTGAGAAGAAATAGCTGCAACTGGTAACTTGCTGGGGAGCAAGGCCTCCTAGTATCACAGCTAATTGACATAGGCATGTCCTGTAGC
AAAATTTGCCTTGAACATATTACCAAGGAACCAAGAAGATGCCGAATGATCTCCAACGGGCAGCAAAATCATCACAGCCATTCAAGAAATTAAAAATAAC
AACATGGCATTTTCTGACATTTAAGGTGGTGTTTGAATCTCCTGAAGATGAAGGCTGTGTTTAGTTCACACTGAAGTTTGAAAGTTTGGTTGAAATTGGA
ACGATGTGACTGAAAAGTTGTGTGTATAAAAGGTTTGATGTGATGGTAAGTTGGAAGTTTGGAAAAAAAACTTTGGAACTAAATAGGGCCGAAGATAAAG
ATTAAGTGTTTCACGCAAAACGAGGTGGTAATAAAGTGAAATACTATGCCACTGCTTCAGATATCAATGTTGCATTTGCTGACATTTAGTAGGTATATGC
AGAATGGAATGACCCTTTCCATGTGAAAATCAATCACCAAGAAAACCAGATAGAACAAAACGGAAATATTAGGGAAGGACCTAATATCAAATAATTATAA
GGGGTGAGGCTTCGAACCCAGGTCGTCTAGCCCACCACCTTGTGGAGTTAGCCGGAAGACCCCTAGGCATTTCTCCGGATAGATAGAACTGAACCCCATA
AAACCATTCGTCCGTATTACTCCAAATCCCGTTGCAAAGCACGGGCATAGCACTAGTGCATGAAAAGAAAAAGGAACTGTAGCCAATGCGAAGAATACAA
ATGCTTGAGGAACACAACTGCATCGAGCACCTTCATTGGGCTCAGCTTCGCCTTTGATCAATCAAATAACCCAACCCCCACCATCCCTTATCACCAGACC
TATCAGTTCTAGCGGTAGTGGAGCTACCCTGGTTATCATTCGAAACGAATGACCATCCAAGGACAAAGCCACTGGCATTAGCACATGACTAGAAAGGCTC
AAAGGGGGTAGAGGGAGGGTCCAATTTAATACCCACAGCAGCCTCAATTGCTTGAAGGCATGCTTATTTCAGCCAAGGTCGATCGTCATCGCCCTCTGTG
TTCATTACGGACCATACGTAGTACCCTGCCACAAATACAGCATATGCTGATGCGATCACCAACACTAAGAGCAAGTATAATAGTATAGCCAGATCTACAG
CCTGATTTTCTTCTTCTTCTTCTTCTTCTTCTTCTCTCTCTCTCTCTCCTCCAATTGTACCTGCTCTAACGAGCCAAGTCGGCTCAAGCTCACGACGACG
ACCAAAACCCCCAAGAGTCCAGCCGATCCGGACACCACCCTAGGTTCCAATTGCCTTCACTGCACGGCGGCGGCTCACCTTAGAGATGGGAATCCGGACG
CTGCGGCCTCTCGGCGGATTGATCGTCGGCAAGCTGTGGGAAGGAATTCCTGCGAAACCCCTTTTAACAATGGCATAATCTCCAATTTCTCGTCGTCAGC
AAGCAACTGCACTTGACATTGGGTCGGTTAGGGTATAAACACACAAGCACACAGCACACGGTGCGCCATAGAGGCCGTGAGGGAGAAGGACGAGGAAGAG
AGATTGTGGTGGTGATGACCGAATCTCGAAAACGTGGCTAAAAACGAAATCGAAAGAAAATCCATGGCGAGGCGGCTCAGATCTCACCTTGGCCG