Detailed information on CNT30116837


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693527Oryza nivaraOryza sativa51.3656.7199.44359forward
CNT30553706Oryza nivaraOryza glaberrima10097.2299.43699forward
CNT30604161Oryza nivaraOryza punctata98.4393.2288.66688forward

Expression of CNT30116837

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MYIVGLTMLAVTTSSSTGKSSNSPRERFSEVWLSSEQQQVNHQQCA*

Sequence

>CNT30116837
TTAGGAGAAGATTAATAGCAAGTAAATAGTAGGCCAAACCATGCAAACTTACATAAGTAAGGTTCAAGTGCAGTCATAACACAATATACACTAGTTTGAT
AAACAAACTTTATTCAGCAGCAAGTAAATAAGGTAACACAAAGCGAATATCTGATCCTCAGTAGCGCGCCAGGCTAGACAGGTTCGGATCATAGAGCATC
GCCATCGAGAACTAGGCCAAACCTTCAAAACAATGTACATTGTTGGCCTCACAATGCTTGCAGTGACCACCAGTTCGAGCACTGGTAAATCCAGCAACAG
TCCACGAGAAAGATTCAGCGAGGTTTGGCTTAGCTCGGAGCAGCAGCAGGTAAATCATCAACAATGCGCATAGTTGGACGCGAGTCACCAGATGGAAAGG
CAGCAGATAGAGTAGTACTGTATGTGAACTGATCCATGGGATAATGCCAAAATTGGTTGTTTGGCAAAGGATATGCATAGGATAATCTTGTGTCTGGAGC
AAAGATATCATCCATATTTACATAATTTTCACTGTTAGGAACTCCAAAGTATGTGGGCTGTTGTTCAGTAACACCAGCATTGGACGGAGAAAATCCATCA
CCATTTGGCACACCCAATTCAGCAAGCCCTGCAATTTCATTGTACAGATCATTTGTGCTAACCTCAAAAGCATGAGCTTCAGCTTCAGACATTGGTGGG