Detailed information on CNT30116769


BLAST search results

BLAST vs Swiss-Prot:
sp|A0A4D6Q411|MYB1_CROXC, E-value = 2e-27

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693456Oryza nivaraOryza sativa36.5939.1699.78446forward
CNT30286652Oryza nivaraTriticum aestivum15.0928.7988.04184forward
CNT30222247Oryza nivaraHordeum vulgare9.1926.9283.93112forward
CNT30660555Oryza nivaraTriticum dicoccoides15.0948.2984.24184forward
CNT30596213Oryza nivaraOryza meridionalis46.7633.8791.75570forward
CNT30370278Oryza nivaraOryza glumipatula24.228.3997.97295forward
CNT30604122Oryza nivaraOryza punctata17.3923.5897.17212forward

Expression of CNT30116769

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MCQGDRAIQRRRKKKKKKKQMVNTSVSRAF*

>peptide 2 (60 aa)
MQHRMLIYACIYRERKKNKNKNKNNQEEKKKRKKKKQSMDGWMFDGKEIYIEREGGMQCM*

>peptide 3 (52 aa)
MWVRQKFLISLSVRPGRLRAMRDQRLPHWEWRWRMRRSSSAVMRPRLRPGWR*

>peptide 4 (39 aa)
MHACLHLLVKYCIIHRSSTASRLINFDHATPHVNLRMHI*

>peptide 5 (31 aa)
LIPSVLTTNTLSPTCTHKLGMLIDQAIARYI*

Sequence

>CNT30116769
CTTGATCCCATCAGTCTTAACTACTAATACTCTCTCCCCTACATGTACACACAAGCTAGGCATGCTGATTGATCAAGCTATAGCTAGATATATATAAAGC
AGAGTTGTCTGACAAGCAATGCATAATACGTGCATCATCAGGTGTAATTACAGTAGACAGATGCAAGGATATGCAGTGCAAATATAGATTTCGCAGTTCG
TTCATCAGATGATGAGAGTCGTCGTCGATCGATCGTCAGCTAATTAAGCTAAGAGCAGCAATTGAATTAAGGCGTTGCTTGTTTGCAATTTGAGTAGTAC
TATTGCGAGGCATCGAGCATCTTCTTGTAGTACTCCTCGTCGTCGATCCTCCACAGCGAGTAGTCGGTGCAGAATTCCCAGACCGGCGACGGCGGCGAGG
CCATCGCCGCCGCGTCGTAGCAGCTCGTATCGGCTTCCGCCGCCGCGATGTCGTTCCAGAGCTGGTCCATGGTGTAGTCCATCGTCAGCAGCTGGCTCGC
CGGCGTGGTGGCCGCCGCCACCAGCTGGTCGACGGCCTCGTCGTCGGCGCCGGCGATGGTGAATTGGTCTTCTTCTTGGCGTGGTGGGCGATCTTGCGCA
TGTGGGTTCGCCAGAAGTTCTTGATCTCGTTGTCGGTGCGGCCGGGGAGGCTGCGGGCGATGCGGGACCAGCGGCTGCCCCACTGGGAGTGGAGGTGGAG
GATGAGGCGCTCCTCGTCGGCGGTGATGCGGCCGCGCTTGAGGCCGGGGTGGAGGTAGTTCACCCACCGGAGACGGCAGCTCTTGCCTGTGCGCTTCAAA
CCTGAAAGGTGAAACCACCAAGGCCAACATGTGCCAGGGAGACAGAGCCATCCAGAGGAGGAGGAAGAAGAAGAAGAAGAAGAAGCAGATGGTTAACACC
TCAGTTTCCCGTGCGTTCTAAGCTCATGCATGCATGCCTCCATCTCCTAGTTAAGTACTGTATCATCCATCGATCATCGACCGCCTCTAGATTAATTAAC
TTCGATCATGCAACACCGCATGTTAATTTACGCATGCATATATAGAGAGAGAAAGAAGAACAAGAACAAGAACAAGAACAATCAAGAAGAGAAAAAAAAA
AGAAAGAAAAAGAAGCAGTCGATGGATGGATGGATGTTTGATGGGAAGGAGATATATATAGAGAGAGAGGGAGGCATGCAGTGCATGTAGCTAGGTCACC
CGCCACCGCGCAAACCTGA