Detailed information on CNT30116760


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693833Oryza nivaraOryza sativa99.0610099.68630forward
CNT30553643Oryza nivaraOryza glaberrima99.6998.1499.53634forward
CNT3067518Oryza nivaraLeersia perrieri28.6234.2785.71182forward
CNT30596240Oryza nivaraOryza meridionalis78.9394.7297.21502forward
CNT30370327Oryza nivaraOryza glumipatula99.5398.9199.68633forward
CNT30108575Oryza nivaraOryza longistaminata87.5893.9397.67557forward
CNT30101831Oryza nivaraOryza rufipogon10099.0799.37636forward
CNT30576567Oryza nivaraOryza barthii99.8499.3799.69635forward
CNT30604159Oryza nivaraOryza punctata35.2242.2688.39224forward

Expression of CNT30116760

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MDASPHYAAAGCVTFAAIRGRETDEIKRCLDIICG*

>peptide 2 (55 aa)
MDSNKKNLQPPPGYPTVDSEHGGRGRTTARGRKTRFIDGCIAALCCCWLCDLCCD*

Sequence

>CNT30116760
ATTCAAACAACACAAATTTGACAAAGAAATTAACGCAGCTAGCTACTTGATCAAAGAAACCTCTCCTTGATCTAGTAGTGCGAGCTAGCTAGCTATAAAT
TCGCAGTAGAACGCAGCCAGTGTGTAGCTAGCATGGACAGCAACAAGAAGAACCTGCAACCACCACCAGGCTACCCGACGGTGGATTCAGAGCACGGCGG
CCGCGGACGAACGACGGCTCGCGGGAGAAAGACCAGATTCATCGATGGATGCATCGCCGCACTATGCTGCTGCTGGCTGTGTGACCTTTGCTGCGATTAG
AGGAAGGGAAACAGATGAGATTAAAAGATGCCTTGATATTATATGTGGATAGTATTTCTACATGGGTGTGCTGAAAAGAGGATCTTTGGAGCAGAGAATT
GAATACAACGAAATGTTGTTGCAGAAAGTATACATCCCGTAATTTCTGCGTATATTTTCGATATATATATAGCGCGGAATAATGAATAATGATATGCGTG
AAGTATCTATGTAATTCATTAATTACATAGTGTGCTCGTTTTGATTTGTATCCATTTTTCAGCTCATTTATTTTGACCCATATAAAAATGTATAGATAAT
CTGATTCCTCAATTAATGAGTTAATCTTTCCTTGGC