Detailed information on CNT30116661


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30370348Oryza nivaraOryza glumipatula20.1627.55100100forward

Expression of CNT30116661

Peptides detected in this lncRNA

>peptide 1 (67 aa)
WNARLKEKKTCFFSPSTKVTTVVVLMEACMTDMELPSTCLDYTDPRQNMENMDQRTIQTTKKEKDER*

>peptide 2 (39 aa)
ECEIKRKKNMLLLSINQSHNSSSTNGGMHDRHGTTLNLS*

Sequence

>CNT30116661
TGGAATGCGAGATTAAAAGAAAAAAAAACATGCTTCTTCTCTCCATCAACCAAAGTCACAACAGTAGTAGTACTAATGGAGGCATGCATGACAGACATGG
AACTACCCTCAACTTGTCTTGACTACACTGACCCCAGGCAAAACATGGAAAACATGGATCAAAGAACGATCCAAACCACAAAAAAAGAAAAGGATGAACG
ATGATTAGTGGAACAAGGACGACGACGACGGACGACTTTCTTCTTCTTCCTCGACGCAACCGAGTCACCATTTGATTAGAGCTGATCAGACAGCATGGAG
CTAGCTTCTCCTTCGCCACACAAGAGCAGACGACGGCATTGCGATCCCAAGCAGCAGCAGTAGTATAGGAGGTAGTAGTAGTAGTAGTAGTAGTAGAGGT
TAGCGTTGAGGAAGTCGGAGATCTCCTCCATGACCTCGTGGTAGTGGACGGTGTTGGGCAACAGGTAGAACCCCACCGTGGCGTTCTCGCATTGGA