Detailed information on CNT30116408


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONOSAT000451, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30101257Oryza nivaraOryza rufipogon56.4531.8999.46560forward

Expression of CNT30116408

Peptides detected in this lncRNA

>peptide 1 (36 aa)
RAPRALSLLLCLATTGHRRYPLPERCWPSPCAIGFA*

>peptide 2 (51 aa)
SSSSSLSPVMSSHHRPPSISLTGALLAKPLRHRVCLDEANPFHPFPLSLPL*

>peptide 3 (33 aa)
MVDFRVASTVPTDIKLPSTCEEHTSTTAILVWA*

>peptide 4 (58 aa)
MFCRRRRSLSTTGVPAPLLSLLSTHSATEKRKRTGGRRRKKKEKRKGKLTESILDGSL*

Sequence

>CNT30116408
CGAGCTCCTCGAGCTCTCTCTCTCCTGTTATGTCTAGCCACCACCGGCCACCGTCGATATCCCTTACCGGAGCGTTGTTGGCCAAGCCCTTGCGCCATCG
GGTTTGCCTAGACGAGGCGAATCCATTTCACCCCTTTCCCCTTTCCCTTCCCCTTTGAAACAAACCATCACAGCCACTTCCTCTTGTTGCCGGAGCAAGC
TATTGCCGTCGCCGTTCCGGTCTCCTCCCTAAGACCCTAACCCTCTCTACCGGAAACCACCCTCCCTGCGTGCGCGTCGCTCGGGAACATGTTTTGCCGC
CGACGTCGAAGCCTCTCAACCACCGGAGTACCGGCGCCCCTCCTCTCCCTCCTCTCAACTCACTCGGCAACAGAAAAGAGGAAGAGAACGGGAGGAAGAA
GAAGGAAGAAGAAAGAGAAAAGAAAAGGAAAACTGACAGAGTCTATTTTGGATGGCAGCCTGTGATATTTCAAGGATCGGATAATCAGGTTGCCTATCTT
GGATTTATTTGCGTTGGAGCAAGGCAAGTTATTATTCCTCCCCTTTGAGCATAATAATCCTATATTCTATATCTCCGGTATCTTATGCATTAGCCATACA
TGATTTCGAATGCATAACCTGAATATATAGCAAACCAGATATATGCTAGATTTTGCTTAGCCATGCCTAGTTAGATTGCATAAAATATAATAAACTTAGA
TTGGAACAATACGGTAGAAATGGTTGATTTCCGGGTGGCTAGTACTGTTCCAACCGACATAAAATTGCCAAGTACATGTGAAGAACATACGAGTACGACC
GCAATTCTCGTATGGGCATAGACCTAGCTGATTAAGTTATCTAGCAAAGGTGGTACCTCTGTATAGTGGTTCTTCTTAAGTCCTCGCGCAGGAGGCAAAC
TTACGCCGAGCAGGGCGATTGTAATATTTACCGAGGCGCAGGTAAATATTTGAGATAAATTGTGATATCACAAACTGTGTGTGTATTGTGAA