Detailed information on CNT30116266


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30105288Oryza nivaraOryza longistaminata103.874.3585.37574forward
CNT30575686Oryza nivaraOryza barthii101.9972.497.52564forward

Expression of CNT30116266

Peptides detected in this lncRNA

>peptide 1 (38 aa)
VRTDAYTMRSIEYKLINQLCRYTYTSRRMKHALITSWN*

Sequence

>CNT30116266
AGTACGTACTGATGCATATACGATGAGATCCATCGAGTACAAATTAATTAATCAATTATGCAGATACACATATACAAGTAGACGAATGAAGCATGCTTTA
ATTACGTCGTGGAACTGAATCATATGCATGCATATATATCTCATTAATTTACGGGATGAAGGAGGAAATTAAGGCACGCAGATACATATGATGATTTGAA
CAAGGAACAAATTAGACATAGATAGATATATAGTTGTACGTGGCCTGGTGGTCGTTCTTCGTACGTTCTTGTGTGTAGCAAGCAGTGAAGTAGAATGGAG
CAGCAGCTATATTAGTTGCTGCACTGGAAGCCGGAGGGGACGGAGCGGCCGCAGTAGTTGAGGGCCAGGAGCGTGGCGATCACCCCAGCTTTCGTCGCCA
TGCCCACCCACCGCACTGCACCTGCAGATCGATCTCGATCTATGGCCTGGCCTCTACCTAGCTTTGCTTGCTAGCCAGTGTATTCAGATACATCTATGGA
CCAAGGGGTGCACTCATATTTATAATAGGATCGGAGGTACTAGCGGAGTACCT