Detailed information on CNT30116241


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30553271Oryza nivaraOryza glaberrima10053.2898.95569forward
CNT30595889Oryza nivaraOryza meridionalis99.1296.2596.28564forward
CNT30369888Oryza nivaraOryza glumipatula10074.1998.77569forward
CNT30100659Oryza nivaraOryza rufipogon60.2887.7298.54343reverse complement
CNT30575838Oryza nivaraOryza barthii10039.0598.95569forward

Expression of CNT30116241

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MEDTDQELCTVAVEMMSSGKLKPCRHLLFYQDSLHREASMKMVHV*

>peptide 2 (36 aa)
HDPSSLTFLSCLSQELHFLYPPLHRANPMHTRLDRS*

Sequence

>CNT30116241
CATGACCCCTCCTCGCTCACCTTTCTCTCTTGCCTGAGCCAAGAGCTACACTTTCTATATCCACCACTTCACCGTGCAAACCCCATGCACACACGCCTTG
ACAGAAGCTGAGCTAGCTTCTCCTGCGTCGCTGCAAGCTGCTACTTTGGTTCGTGACTGAAAGCCAAATGGAAGATACGGATCAGGAGCTATGCACCGTT
GCGGTGGAGATGATGAGTTCAGGAAAACTCAAGCCATGTAGACACTTGTTGTTCTATCAAGACTCCCTTCACCGAGAAGCATCCATGAAAATGGTTCATG
TTTAGCAATAGTACGGTGTTATCCTAACTGAGCTTTTCTTCTAGCCACCATCCACATCCTTCTTCAAAACCTCAACATCACTTTGTGTGGGAATTAAAAG
GAATTGGTCTTCTTGACCTTGCAAGACCTTTTCTTGACCTTGTAAGACCCAACATCGTTGTGTTGCTTTCCTTGTTTCTTATTTTTCAATTTCATCCACC
TCTTCTTTCTACCTCCCATCTTTCTCCTAGTTCTTGCCTTCTCTCTCGGTCTATCCCTCCTGAGCTGTA