Detailed information on CNT30116075


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SRN0|NHL1_ARATH, E-value = 4e-31

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691407Oryza nivaraOryza sativa20.3940.59100207forward
CNT30519659Oryza nivaraSetaria italica26.834.8788.97272forward
CNT30552692Oryza nivaraOryza glaberrima22.96100.8799.14233forward
CNT30461908Oryza nivaraSaccharum spontaneum23.6519.489.17240forward
CNT30132292Oryza nivaraLolium perenne17.0450.2985.55173forward
CNT30365453Oryza nivaraSorghum bicolor5.8122.2688.1459forward
CNT30595730Oryza nivaraOryza meridionalis48.5765.3893.31493forward
CNT30369597Oryza nivaraOryza glumipatula6.2125.5110063forward
CNT30109084Oryza nivaraOryza longistaminata20.8919.3397.64212forward
CNT30592989Oryza nivaraEragrostis curvula4.3321.8990.9144reverse complement

Expression of CNT30116075

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MCCNGIHMNVRNFILSHRVCMSYMNTKKKKLTACGLTRPMNLINYHIATSRYSNL*

>peptide 2 (55 aa)
MKPTTRTSARMHAAIPPQHRRRWCSRLWCFSLLMAATAAAAAARANLATSSRVRE*

>peptide 3 (30 aa)
SREILPEYILLTIIQKLQQRNYTSTLHIGN*

Sequence

>CNT30116075
TTCTCGAGAAATATTACCTGAATATATATTATTAACAATAATTCAAAAATTACAGCAACGAAATTATACTAGTACACTTCATATAGGAAATTAATGTGTT
GCAATGGTATACATATGAACGTACGTAACTTTATTCTCTCACATAGAGTATGCATGAGCTACATGAACACAAAAAAAAAAAAATTAACAGCTTGCGGATT
AACGCGACCGATGAACTTAATTAATTACCATATTGCCACTAGCCGCTACTCAAATTTGTGACTCACACCTCGACGCTGCACCCTGTCGGCTGCGTGAACC
TGAGCGACGCGACGGCGCCGGCGCCGGTGCCGTTCACGACGGCGGCGGAGGCGCCGCCGAGAGGCATGGGGCCGACGCCGCCTGGTCCGGCGGAGGCGAG
CATGGCGGGGCAGCTGACGAAGAGGTGGTAGCTGCCGGAGACCCAGCTGCCGACCTTCCACTTGACGCGGCCGTCGACCTTCACCTGCAGCGCGACGTAC
CCGGCGGCGACGTCCTGCCTGAGCGCGTCGGCGACGAAGCCCGCCACGGGGACGGACTCGCCGGAGAGCACGGGCGACCAGATGGTGACGTCGCGGTGGC
CCTGGTAGGTCGGCGGGAGGGAGACGGGCACCGTGACGGGTTCGTCGCGGTAGGTGACGAAGACGTCGACGGAGCGGAGCTGGAGGTCCTGCAGGTAGAA
GGACGGCTTGGAGGGGCGGAGCGCGAGGTAGACGACGAGCGCGATGAAGCCGACGACGAGGACCAGCGCCAGGATGCACGCCGCCATCCCGCCGCAGCAT
CGCCGGAGGTGGTGCTCCCGCTTGTGGTGCTTCTCCTTGCTCATGGCGGCGACGGCGGCGGCGGCGGCGGCGCGAGCTAACTTAGCTACGAGTAGTAGAG
TGAGAGAGTGAGCTGCGAGCTGTTGCTGAGTGAGAGAGAGAGAGAGAGAGAGAGAGGGGCGTTAGATATGAAAGCGAGTAAGAGAGTAATAATGGCTTTT
AAGATTAGTGGAGCG