Detailed information on CNT30116022


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003145, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691349Oryza nivaraOryza sativa42.2868.3498.77326forward
CNT30552707Oryza nivaraOryza glaberrima91.5789.3799.58706forward
CNT30100358Oryza nivaraOryza rufipogon83.453.8197.82643forward
CNT30575146Oryza nivaraOryza barthii82.175.7299.05633forward

Expression of CNT30116022

Peptides detected in this lncRNA

>peptide 1 (91 aa)
MWQGRLRLGVITLDLLHGDGGVVVVIAVSHHGSRSWRGRGRHHGCRRSRRGEARRRGRRSMLAGMVLVAGQLLLDLLLEPLLLLPLDHLAVV

>peptide 2 (30 aa)
MQAEPARGSPSPRAEEHARRHGPCGRAASP*

>peptide 3 (34 aa)
LRRSSRKCDHNAVYPSRVVQYNCTRQQYILGRNH*

Sequence

>CNT30116022
TTGAGAAGATCTAGTAGAAAATGTGATCACAATGCAGTGTACCCCAGTAGAGTAGTACAGTACAACTGTACAAGGCAACAATATATTCTGGGCAGAAATC
ATTAATACCAAGGCAGAATGCCCAGCCCAAAACCAATACAAGAGTGCCAATAATAATTAAACAAACTCAACATCTAGTACTTGACTATAGCAAACTGAAG
CCCGTACCCCACACGAAACACAAACTTCGATCACTGATCGGGCTTCACTGACCAGGCCTTGACCAATCTTGACACGAACTTAACAAAGCTGCAGTGCAGA
AAAAGCACCAAACTAACACACGCCAAACACTTCCAAATTCCAACCATGGCCTGGTCTCACACACGCCCCAATTAAGCGCTGCTCTTGTGCTCGCCGGTGG
CGGCGGCGGCGTTGCGTCTTCCGGCTTCTTGTGGCCGCCGGGCAGCTTCTCCTTGATCTTGTCGAGGAAGCCCTTCTTCTCCTCCTCGGGTGCATGTGGC
AGGGTCGCCTCCGTCTTGGCGTGATCACCCTCGATCTTCTCCACGGGGACGGCGGTGTCGTGGTGGTGATCGCCGTGAGTCACCACGGGAGCAGGAGCTG
GCGTGGGCGCGGCCGTCACCACGGATGCAGGCGGAGCCGGCGCGGGGAAGCCCGTCGCCGCGGGCGGAGGAGCATGCTCGCCGGCATGGTCCTTGTGGCC
GGGCAGCTTCTCCTTGATCTTCTCCTTGAGCCCCTTCTTCTTCTTCCTCTTGACCACCTCGCCGTTGTCAT