Detailed information on CNT30115971


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT003266, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691303Oryza nivaraOryza sativa91.5663.8499.81995forward
CNT30108168Oryza nivaraOryza longistaminata85.2779.8197.261858forward
CNT30100211Oryza nivaraOryza rufipogon23.27100.299.8507forward
CNT30575176Oryza nivaraOryza barthii29.8398.6399.69650forward
CNT30550641Oryza nivaraOryza brachyantha20.9327.9683.55456forward

Expression of CNT30115971

Peptides detected in this lncRNA

>peptide 1 (72 aa)
QSVSHKFGTMLYSIHTQPSAMVHINSDTRCPKWVHVNSDTSCPKWQGKVHMYKFRYILSKMAREVHKLRTRW*

>peptide 2 (56 aa)
MTCTVYDNIRGSIVFLFTKIQLCRVEVARVYKRLFLRNRNTKYVCYIPVLVRASIQ*

>peptide 3 (93 aa)
MRTYPFLQRTVRLLSRVYNDWPKEVSTDFTVLRDVLTSCKVQSKLSVKLIVTNNIDSFTIVYPVITFLSVMLWKIQLYPTTMETYALNYTHIK*

>peptide 4 (35 aa)
MQSITSTSVLASLFLNPPQSFTSSLLKIPYYKVIV*

>peptide 5 (35 aa)
MEGVRFEILPPQCYENISLFTENSPSSQQSLQRLA*

>peptide 6 (42 aa)
MDPSESSEGKFSLLSVQLVGSFSLEPAETINSALLDFYAVVS*

>peptide 7 (52 aa)
AIRFSQIWHNAIQYTHTAQCHGSYKFRYTLSKMGSCKFRYILSKMARKSTYV*

>peptide 8 (33 aa)
MYDIDRLGCNTHVKGKTIRFYRVKLFGKQVSYQ*

Sequence

>CNT30115971
GCAATCCGTTTCTCACAAATTTGGCACAATGCTATACAGTATACACACACAGCCCAGTGCCATGGTTCATATAAATTCAGATACACGTTGTCCAAAATGG
GTTCATGTAAATTCAGATACATCTTGTCCAAAATGGCAAGGAAAAGTACATATGTATAAGTTCAGATACATCTTATCCAAAATGGCAAGAGAAGTACACA
AATTAAGAACAAGATGGTAACACCGACATAGGTTCCTACAGCAGCAAAATACAATACAGGTAGCAGGCACCATGGTTAAATAGGTTACATACAATGCTTG
GATATAACTCAGACAACTAAAACCTATCGAGTGAATATCTCAGGCAGCCTGTCCGCCCAAGAGACAAGCCCACGGACTAATGGTTGGCCTACAAGGGCAG
ATCGATCTGGCGATTCTGAACTAACCTACTACTATACTCACTTTGAAAGGACTGTGTTCTAGTTACAGGTAACCAGGTCTTCAGCTTCACCATCCTACAA
CTACTATGATCACTGCTCACATTGAAAGGACTGTTGTTCTAGTTACAGGTAACTAGGCCTTTAGCTTCGATCACCATGGACCCGTCAGAGTCCTCCGAAG
GCAAATTCTCTTTGCTGTCGGTCCAACTTGTCGGCTCATTCTCTCTAGAACCTGCAGAAACCATTAACAGTGCATTATTAGACTTTTACGCGGTGGTGTC
TTGAAGCCAGAGGAAAATCTCAAACTAGGAAACGAAAAGCTTGGAAACTTCTCTCCCAAATTTACCAGGAACAATTGTCAGATAGTATGCTGACAGAAAA
ATAAGGAACCCCATTTTGAAGTCATTAAAACCCAACCAAAGGACAACATAAATTAAATAGAATTGAGTGGTGATTTGCTTTTTCAAAAATGACTTGTACA
GTTTATGATAACATCAGAGGCTCCATTGTTTTCCTTTTTACCAAAATACAATTATGTCGAGTAGAAGTGGCAAGAGTCTACAAGAGGCTCTTTCTCAGAA
ATAGAAATACCAAGTATGTGTGCTACATACCAGTATTAGTTAGAGCAAGCATTCAGTAATTCAGTTTTTGTCCAATCCACATTTTTTCAGGGTTAGAGTA
GCCTCTAAAAAACTGATGATTCTAAGTTTCAAACCATTTGTGGCACTCCCTTAGCTTCTGTACACATTCAAACTAGTGGTCTAAGATGTGGAAAAACAAC
TAGGACATGGAGGGAGTGCGGTTTGAAATTCTGCCGCCTCAGTGTTATGAGAACATATCCCTTTTTACAGAGAACAGTCCGTCTTCTCAGCAGAGTTTAC
AACGATTGGCCTAAGGAGGTATCCACAGATTTTACAGTGTTGAGAGATGTGTTAACTTCATGTAAAGTTCAGTCAAAATTGTCAGTTAAATTGATTGTAA
CAAACAATATTGACAGTTTCACAATTGTCTATCCTGTCATAACTTTTTTAAGTGTTATGTTGTGGAAAATACAGTTATACCCCACTACGATGGAAACATA
TGCATTAAACTATACACACATCAAATAACTGTTTTTTGAATAAACTTTAATATTTGCTTGCCCTTCCAATGTTGCATTTAGTTAAAACTGTATTATTATA
GATGAAATATCATTTAAATGGTTATAATTCAACAATGATGGCAGTTGACTGATCAATTCAAAGAATTTCTTTTTTAGTTTAAGCCATTTAAATGCTGCCA
CCTAACCCCTGATGTAGGAAAATGCAATCAATCACATCGACATCAGTCCTTGCCTCATTATTTCTCAACCCCCCACAAAGCTTTACTTCATCATTGCTTA
AAATCCCATACTATAAGGTAATAGTGTGAAAGCCAAAACTCACGACCAGTAGCTATCAATCAGAACATAACGTTTGACATTCAAACAAGTGAATCAATAA
TTGTTAATATACACAGCATACATTTTCCTAACAATAATTGTTAAAATTCACACCATACATTACGAGCGAAAAATAATCATAGAGCAGAGCATATGTATGA
TATTGACAGATTAGGCTGTAATACTCATGTAAAGGGTAAAACTATCAGATTTTACAGAGTAAAACTTTTTGGTAAACAAGTAAGCTATCAGTAAAACAGA
GCATGCCTAGGTTGCACAGCTTCGTTTTGTTTCTTGTTTGACATTAATAAGCAAAACATAGTACCTATCCAGAGCAAAA