Detailed information on CNT30115924


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ZVX8|PIP28_ARATH, E-value = 7e-19

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691396Oryza nivaraOryza sativa36.1753.799.75399forward

Expression of CNT30115924

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MAAPRLRAGWTRKTAKPMGSGARMGTWESLALRLASVAEKTV*

>peptide 2 (31 aa)
MNLDSICIFRFIIIRCVTFRLVFYRMDGVAK*

>peptide 3 (94 aa)
MVGCIRGRAMRGRGYRRWRRRGCGRGGRGRRRSRWGAAPGWGRGSPWRCAWRRWRRRRCRRGRRSCRRTTTRCPGSPRWRTWTPTCSPPSPSGC*

>peptide 4 (46 aa)
MPPNDHAMPWIPTVAHLDADLFTPITVRMLMYRNRNVATNSAIPAR*

>peptide 5 (42 aa)
SHQTYYVHIDIITATSDIYKRAYNYAAASFIDHQTVITHVVL*

Sequence

>CNT30115924
TCACACCAAACATACTACGTACACATAGATATAATTACAGCAACATCAGATATATATAAACGCGCTTATAATTATGCAGCGGCTAGCTTCATCGATCACC
AGACGGTAATAACACACGTAGTACTGTAGAGACTTGATCCTCCATCATCTTGCAGCATCAACTCGGTTGATTATTTCAGAGTAATTATCGCTTAATTAAG
ATGATGATGCATGGTAATTAATTAGTCCCGACTCTTGAAGGGGATTGCTCTGATCACCACCACGTGGTAGATGGCCGCCAGTGCCGCTCCGATGAACGGA
CCAACCCAGAAAATCCACTGCACAAATCCATCCATCAATTAGCACTAATCAATGAACTAAATTAACGTGCGATTATTAGCAACTACTCCCTCAGATCCCA
TAAAAAACGAATTTAGTAGGATGAATTTAGATAGTATATGTATATTCAGATTCATAATAATAAGATGTGTCACGTTTCGGTTGGTTTTTTATCGGATGGA
TGGAGTAGCTAAGTAGTTGAGAAAGCATTAAATAATGGTTGGTTGCATACGTGGTCGTGCCATGCGTGGGCGCGGTTATAGACGATGGCGGCGCCGAGGC
TGCGGGCGGGGTGGACGAGGAAGACGGCGAAGCCGATGGGGAGCGGCGCCAGGATGGGGACGTGGGAGTCCCTGGCGTTGCGCTTGGCGTCGGTGGCGGA
GAAGACGGTGTAGACGAGGACGAAGATCATGCCGCCGAACGACCACGCGATGCCCTGGATCCCCACGGTGGCGCACTTGGACGCCGACTTGTTCACCCCC
ATCACCGTCAGGATGCTGATGTACAGGAACAGGAACGTCGCCACGAACTCCGCGATCCCCGCCCGGTAGAACGACCACGACGTCAGCTCCTCCACCTCGA
ACACCGGCGCCGCCGGCGGCTCCCGGTAGTCCTTCTCCTCCGCCCCCTGCGCCGCCGTCCCGATCGGCTGCCTCTCCGTGTACCTGTTCGCCCCCAGCCT
CACATCCTCCTCCTTCCCCTCCATTACTATTAATTTGCCTCTTCTTCTTCCTACTACTCACTACTAGTTCTCTTGCCGGAGCCGGAGACGACGACGACGA
CGA