Detailed information on CNT30115905


BLAST search results

BLAST vs Swiss-Prot:
sp|P29195|CAPP1_SORBI, E-value = 3e-42

BLAST vs NONCODE:
NONORUT002772, E-value = 1e-121

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673967Oryza nivaraSetaria viridis47.8546.9780.47256forward
CNT30521394Oryza nivaraSetaria italica47.857.0980.47256forward
CNT30316271Oryza nivaraCorylus avellana13.8320.1687.8474forward
CNT30193220Oryza nivaraSecale cereale48.2229.1284.11258forward
CNT30475137Oryza nivaraSaccharum spontaneum48.2238.9181.78258forward
CNT30140847Oryza nivaraLolium perenne48.7945.7981.99261forward
CNT309351Oryza nivaraZea mays37.0144.184.85198forward
CNT30368707Oryza nivaraSorghum bicolor42.0628.8882.22225forward
CNT30369646Oryza nivaraOryza glumipatula98.8899.4498.87529forward
CNT30148536Oryza nivaraBrachypodium distachyon15.739.2591.6784forward
CNT30583436Oryza nivaraEchinochloa crusgalli48.0428.1880.16257forward
CNT30497176Oryza nivaraDigitaria exilis48.4125.7781.08259forward
CNT30557319Oryza nivaraPanicum hallii42.0619.9380.89225forward

Expression of CNT30115905

Peptides detected in this lncRNA

>peptide 1 (66 aa)
RRMIGPYILFWIGLQKPNKSPLDIYIKYTTKRKRASKKKSLQNSLASANVLVKHIHHLIMEGVIDD*

>peptide 2 (59 aa)
MPAAMPFIVRMRVSSRPGAYSLAAFSWTSSAGWLLSTNSFDKAGCDITSKLGSLIRFRV*

Sequence

>CNT30115905
TTCGTAGAATGATTGGTCCATATATTTTATTTTGGATCGGGCTGCAAAAGCCAAATAAGTCCCCCCTTGACATTTACATCAAGTACACAACCAAAAGAAA
ACGTGCGAGCAAAAAAAAGAGTCTCCAGAATTCACTAGCATCGGCGAACGTACTAGTTAAACATATTCACCATCTCATCATGGAAGGAGTTATTGATGAT
TGATTGATTGCACCTGCTGGAAGCATTCTTGTGGACAATCTAGCCTGTGTTCTGCATGCCGGCAGCAATGCCCTTCATCGTCAGGATGAGGGTGTCCTCC
AGGCCAGGTGCGTACTCGCTCGCAGCGTTCAGTTGGACCAGCTCGGCAGGCTGGTTGCTGTCGACGAACTCCTTCGACAAGGCCGGCTGCGACATCACCT
CGAAGCTAGGGTCCCTTATCCGCTTCAGGGTGTAGGCTTGGCAAACGTTCAAGGTAGTGATGTACGACTCACGCAGCCGCAGACGCTGCTTCAGGTATGA
TCCTGCTAACAAGAAGATCGAACATGATGTTTAGA