Detailed information on CNT30115854


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 9e-102

BLAST vs NONCODE:
NONMEST001181, E-value = 4e-94

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691328Oryza nivaraOryza sativa97.7599.4699.46737forward
CNT30191038Oryza nivaraSecale cereale61.852.4292.49466forward
CNT30301530Oryza nivaraTriticum aestivum62.0726.4793.16468forward
CNT30397375Oryza nivaraTriticum turgidum61.9426.8492.51467forward
CNT30253103Oryza nivaraAvena sativa61.5462.9692.67464forward
CNT30667831Oryza nivaraTriticum dicoccoides61.4160.4492.44463forward
CNT30461506Oryza nivaraSaccharum spontaneum61.9439.2890.58467forward
CNT30686251Oryza nivaraTriticum urartu62.072291.24468forward
CNT30349330Oryza nivaraEragrostis tef62.0730.1991.03468forward
CNT30595696Oryza nivaraOryza meridionalis96.9568.7796.03731forward
CNT30150050Oryza nivaraBrachypodium distachyon62.0734.9891.24468forward
CNT30100520Oryza nivaraOryza rufipogon98.1474.692.97740forward
CNT30575387Oryza nivaraOryza barthii75.8610099.3572forward
CNT30583294Oryza nivaraEchinochloa crusgalli62.0724.5990.17468forward
CNT30550711Oryza nivaraOryza brachyantha85.0191.5791.11641forward

Expression of CNT30115854

Peptides detected in this lncRNA

>peptide 1 (61 aa)
MRRCWSGGMPSLSWILALTLSMVSELSTSRVMVLPVRVLTKICIPPRRRSTRWRVDSFWML*

>peptide 2 (47 aa)
MRRCWSGGMPSLSWILALTLSMVSEDSTSRVIVLPVNVFTKICICKK*

Sequence

>CNT30115854
TTTAATAAGAATATGCAGCATTTTCAAACTTGCAACTCAGATAAAACATCGACAGGAATGAGATGCAAATGAGCAAATTGAGCACATATTTAGGTTCAAA
TCCAACTTATTCATAAAGCATACTGCTGTCCACAGGAAACTGTTTCATAAAACTAACATATCATACGGACTCGATGGTCCATTAAACCAGACACAAGTAG
ACATCAGCACCACAAATACTTGACGAACAGAGGCTCGGGACGACCAGGCACATCGGCAGCTCCACCAAACTGGCTGATTACTGACCACCACGGAGGCGGA
GCACCAGGTGGAGGGTAGACTCCTTCTGGATGTTGTAGTCGGCGAGGGTGCGGCCATCCTCGAGCTGCTTGCCGGCGAAGATGAGACGCTGCTGGTCTGG
GGGGATGCCCTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTCCGAGCTCTCAACCTCCAGGGTGATGGTCTTGCCTGTGAGGGTCTTGACA
AAGATCTGCATACCACCACGAAGGCGGAGCACAAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCAGCAAGGGTCCTGCCATCCTCCAGCTGCTTGC
CAGCAAAGATGAGACGCTGCTGGTCCGGGGGGATGCCCTCCTTATCTTGGATCTTAGCCTTGACATTATCGATGGTGTCAGAGGACTCCACCTCGAGGGT
GATAGTCTTGCCGGTCAATGTCTTCACAAAGATCTGCATCTGCAAGAAATAATC