Detailed information on CNT30115801


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT006488, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696891Oryza nivaraOryza sativa15.8840.7494.49363forward
CNT30551995Oryza nivaraOryza glaberrima27.7342.8498.26634forward
CNT30106115Oryza nivaraOryza longistaminata15.9738.8791.78365forward
CNT30103901Oryza nivaraOryza rufipogon30.0561.7391.99687reverse complement

Expression of CNT30115801

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MYSPLHNLTYRGNVLIRRSEGSEIYDKNEFF*

>peptide 2 (31 aa)
MLMKFVMLVWGVWKVFGWFNRIIITPLYHGK*

>peptide 3 (44 aa)
MDEWLRCGHRCSCPGQGRSPSTVSSYMSTGNQGDRGQQRVEPPL*

>peptide 4 (47 aa)
MLSSALQTVDIVWVKLDSLCRGELNHSNVPYSRFWSCAIRVIPTPEV*

>peptide 5 (49 aa)
TKSLADLLPRSLSSNSLAPLASPHSGESILPVFPCLFLLNPATPKLSFS*

>peptide 6 (98 aa)
MRDRNPERSRVDFWGTKPKLGVPTHGDQINGKSCCRGGSVGEDHRSPSLLTSHIVVSSYGRVAPMRPSVFVSWSGTFSIYGFLLHVDGEPRGQGATTS*

Sequence

>CNT30115801
ACCAAGTCACTGGCCGATCTCCTCCCCCGTAGCCTCTCTTCCAATTCCCTTGCACCACTAGCTTCTCCTCACTCCGGCGAATCCATTTTACCCGTTTTCC
CCTGCCTTTTCCTCTTGAATCCAGCCACACCGAAGCTCTCTTTCTCCTGACCGAACCACGCATTATCTTCGCCGTTCCGGCCATCTTACCCTTCCTCTCT
ACCAGCCACCACCCCTCCTAGGAAGCAGGAAGGAAGAAGAAAACGAGAAAGGAGAAGACACTGACAGCGGGGCCCACTGCACAACCATACAGGAAGTTCT
ATCGGCATCCAAGGAGCTGACGTGGACCCAGATGGCTACGCTGAAGCCACGGGAAATATTATGGCACAAGGCAAGACATAATTAAAATTTTGATCATATA
GAAAACTTTATATGATCTTCATATTTAATTTGATGCATAATACCTTACTCTTTTAACATCTCATGGGTATATGTTAAATGCTTTTAAGCATGATTGCATG
AGAACATAGAAAGAAGCATTGGTTATCATTTTATGTGATTTACTATTCCAAATAACTTTACAAACTTAGGAATCCGGTTAAAATGGGCATTTATGAGTTG
AGATTATGAATGTTGTGATTATGAATGTTGATGAAGTTTGTGATGCTGGTGTGGGGAGTTTGGAAAGTTTTTGGGTGGTTTAACCGGATTATAATTACCC
CCTTATACCATGGGAAATGATATAGTTGCGTCCATCCACACAACCAAGTAATTGGACTTAGCCTAGTACATTGTCCCATTATATGAAAGACTGTTGGGTG
GCTCTATGAGCGGTTTTGGGGTGAACTTGCGTAAGGAGTTTGGGCGGCAGTGTTTCACAACAGTGGGATTCATGAAAGTGTGACGATATAGATACCTTGC
CTAGGCCTAGCAAGAGTTCGACCACTATGATGAACCAAGACCCCACTGTGTAGTAACTAGTAGTAAGTGGGACTCTCGAACGGCTATGTTGTCCTCAGCC
TTGCAAACTGTTGACATCGTGTGGGTAAAGCTGGACAGTCTCTGCAGAGGTGAATTAAATCATTCGAATGTGCCGTACTCCCGGTTCTGGAGTTGTGCCA
TTAGGGTGATTCCTACTCCTGAAGTATAAGTAGTTTTAAAAATTAAATTGTTGAGGATAAAGATGATTTATGGTTTTCATTACTCCTTTACTTTATTATT
GTTTATTTATTCATATCTATTCATCTTTAATTATTTATAATATGTCTTGCTGAGTACATATGTACTCACCCTTGCATAATTTGACATATAGAGGAAACGT
GCTAATAAGGAGATCAGAAGGAAGCGAGATCTACGACAAGAACGAGTTTTTCTAGGCTAGTCTACACTCGAGTTTTTGCCTGTGTAGTTCTTTGAAGTTC
TTTGGAATTTATTAATTGTAGTTCTAGTAGTTGAAAAAGTTTAGGAGTTTAGTACTTTGGATTTTCTTGTATTTCAAATAAGGATATTTTAGTTTGGATC
TTTTCACCCTTTAACAGTTGTATAATTAGCTTGTATGAACAAACCTGTGTAAATAATCGAAAGCTGTTCAGTATATCAATCTATGCGTGATCGAAATCCT
GAACGATCACGAGTGGATTTTTGGGGCACCAAGCCTAAATTGGGTGTCCCCACACACGGCGACCAAATCAATGGTAAAAGCTGTTGCAGAGGAGGATCCG
TGGGAGAAGATCATCGAAGCCCCTCGTTGCTGACATCCCACATTGTTGTCTCCTCCTATGGACGAGTGGCTCCGATGCGGCCATCGGTGTTCGTGTCCTG
GTCAGGGACGTTCTCCATCTACGGTTTCCTCCTACATGTCGACGGGGAACCAAGGGGACAGGGGGCAACAACGAGTTGAGCCTCCCCTCTGACAAGGGCC
AAGTAAGCTTAAGCTCGGACGGGCTCGCCGGCCGCCTCCTCCTCCCTCTCCCTCCTAGGCTCGCCGACTGCCTCCTCTCCATCTCAGACTGATCGGTTGC
CTTCCTCACGGCCAACACCCAAGCACTGTGTGTGGTTGGGAAGAAAATAGTAGAAAGAAGATGGCGCTGACACACAGGTCCCACAATTTTTCTCCTCACT
TACGTGTGGTTCCCACATTTTTTTTACTTTTTATTTGCTGACTAGGATGCCACGTCAGTGAAATCAGACATTTATACTACTACGAGACCCTAAATTACAC
GATTTTATATAGTTTAGAGATGAAAATTTTTGATATTGGAGACAAAGATGTCAAACAAACTCAACGCAAAGTTAAGAGATGGCGAG