Detailed information on CNT30115761


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30575057Oryza nivaraOryza barthii97.0197.9999.74390forward
CNT30603472Oryza nivaraOryza punctata54.7357.2990220forward

Expression of CNT30115761

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MGGFYCGLIKVGDSPAASVRLLRDFTCRTCSRCRTCPTWSKI*

Sequence

>CNT30115761
GTTCGATTGAGTATGATAGACCTTTTTACTAGGCAAACCACACGAATACACGATTGATTAATTTCACTGAGAATAGCACGGGTACATCACATCACACAAA
TTCATACGTTGATACACGCATAGTCGCCGAAGCGACCAGCTGCTTAATTAATCGATAACACACGGGTTTAATTCAGCAATAATCAGCACACACACAAACC
ACACTCATATGGGTGGTTTTTATTGTGGACTAATTAAGGTAGGTGACTCGCCGGCGGCGAGTGTTCGGTTGCTTCGTGACTTCACTTGCCGCACTTGCAG
TCGTTGCCGCACTTGTCCGACATGGTCGAAGATTTAATTAGCTAAGTGAGTGATGAGTTAATCCCTTGTGTTGCTTATGCTTTCTTGTGCTCTGGTGGTG
GT