Detailed information on CNT30115709


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30115709

Peptides detected in this lncRNA

>peptide 1 (31 aa)
GGPCQSTAAQETHVSLSPPNEGFRVRWVSSS*

>peptide 2 (72 aa)
QEAHVNLPQPRRPMLVYRRPMKDLGFGGSHPPDFLSRSGGGGVVRRGHTQVVVRTARGEVERRASSSLFSSP*

>peptide 3 (84 aa)
MLLSPNACFYSTTNLCDIIVDLAAGNIRFYQQLAVLASLISLAHGWEIGSRHCSMSLSPSSYRPRQRYIAPTRHQTKQLLCSST*

>peptide 4 (71 aa)
MGDWEPALLDVSLTLILSPASTIYSANQAPNKAVVVFLYIEIFTSSLICLMFLLIISYPSPLSWALKLHCQ*

>peptide 5 (41 aa)
MNSIHRLPPSTRHDLFFYDFFCMKLSVNETVAIKGKPRGYA*

Sequence

>CNT30115709
CAGGAGGCCCATGTCAATCTACCGCAGCCCAGGAGACCCATGTTAGTCTATCGCCGCCCAATGAAGGATTTAGGGTTCGGTGGGTCTCATCCTCCTGACT
TCCTGAGTCGGAGCGGCGGCGGCGGCGTAGTGCGGCGCGGTCACACGCAGGTGGTGGTAAGGACAGCGCGCGGCGAGGTGGAGCGTCGTGCATCCTCTTC
ACTCTTCAGCTCACCATGAATAGCATCCACCGTCTCCCCCCATCGACCAGGCATGATCTCTTCTTCTATGATTTTTTTTGTATGAAACTGTCCGTCAATG
AAACCGTCGCCATCAAAGGGAAGCCGAGGGGCTATGCTTAAATTTTAATACCATGTTTAATTCCTTTTTATGCTCCTTTCACCTAATGCATGTTTTTATT
CCACCACTAATCTCTGCGATATCATCGTTGATCTAGCTGCTGGCAACATACGTTTCTATCAGCAGCTAGCTGTCCTAGCTAGCCTCATCAGTTTAGCGCA
TGGATGGGAGATTGGGAGCCGGCACTGCTCGATGTCTCTCTCACCCTCATCTTATCGCCCGCGTCAACGATATATAGCGCCAACCAGGCACCAAACAAAG
CAGTTGTTGTGTTCCTCTACATAGAGATTTTTACATCATCTCTGATATGTCTCATGTTTCTGTTAATTATCTCCTATCCCAGTCCACTTTCATGGGCTTT
AAAGCTGCACTGCCAGTAAATTGAGGTGGTAAGCAGCCATCGAATCATCCGCTCCTAAAATTCTAAGCATTCGTGACAAGTTAATAGATGCTACACTAAG
ACCTTGACTTTGCAACCTTCAGTCTCTAATTCTCTGCATGCATCATTTACTCCAGAGTTCTAATTAACAGGATTTCAGGTG