Detailed information on CNT30115671


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369385Oryza nivaraOryza glumipatula85.1142.6499.62800forward
CNT3099740Oryza nivaraOryza rufipogon85.1137.04100800forward
CNT30575023Oryza nivaraOryza barthii85.1185.3899.62800forward

Expression of CNT30115671

Peptides detected in this lncRNA

>peptide 1 (72 aa)
QEAHVNLPQPRRPMLVYRRPMKDLGFGGSHPPDFLSRSGGGGVVRRGHTQVVVRTARGEVERRASSSLFSSP*

>peptide 2 (46 aa)
MGDWEPALLDVSLTLILSPASTIYSANQVQEVLKFFDDTHVADLLR*

>peptide 3 (31 aa)
GGPCQSTAAQETHVSLSPPNEGFRVRWVSSS*

>peptide 4 (31 aa)
MSLSPSSYRPRQRYIAPTRSRKFLSSLMIPM*

Sequence

>CNT30115671
CAGGAGGCCCATGTCAATCTACCGCAGCCCAGGAGACCCATGTTAGTCTATCGCCGCCCAATGAAGGATTTAGGGTTCGGTGGGTCTCATCCTCCTGACT
TCCTGAGTCGGAGCGGCGGCGGCGGCGTAGTGCGGCGCGGTCACACGCAGGTGGTGGTAAGGACAGCGCGCGGCGAGGTGGAGCGTCGTGCATCCTCTTC
ACTCTTCAGCTCACCATGAATAGCATCCACCGTCTCCCCCCATCGACCAGCTGCTGGCAACATACGTTTCTATCAGCAGCTAGCTGTCCTAGCTAGCCTC
ATCAGTTTAGCGCATGGATGGGAGATTGGGAGCCGGCACTGCTCGATGTCTCTCTCACCCTCATCTTATCGCCCGCGTCAACGATATATAGCGCCAACCA
GGTCCAGGAAGTTCTTAAGTTCTTTGATGATACCCATGTAGCTGACCTTCTTCGATGATACTTTGTTCCCATATCTGATTGGTTGATGTTGATATACATT
GCAATGTGTAGGCACCAAACAAAGCAGTTGTTGTGTTCCTCTACATAGAGATTTTTACATCATCTCTGATATGTCTCATGTTTCTGTTAATTATCTCCTA
TCCCAGTCCACTTTCATGGGCTTTAAAGCTGCACTGCCAGTAAATTGAGGTGGTAAGCAGCCATCGAATCATCCGCTCCTAAAATTCTAAGCATTCGTGA
CAAGTTAATAGATGCTACACTAAGACCTTGACTTTGCAACCTTCAGTCTCTAATTCTCTGCATGCATCATTTACTCCAGAGTTCTAATTAACAGGATTTC
AGGTGAAGGCCATCTGTGGATCCAAAATATATTGTTCTTTGGCTAAGATTTTAGGTCTGGCTGTTTTTCTCCATTTCATATAAGCTTTTTGAAAATATCC
CATATTAAATATTTCTATTTGAGAAACTATCTGGATACTT