Detailed information on CNT30115607


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690094Oryza nivaraOryza sativa87.7758.56100366forward
CNT30552014Oryza nivaraOryza glaberrima93.0596.0499.74388forward
CNT30595443Oryza nivaraOryza meridionalis84.6589.5990.93353forward
CNT30369383Oryza nivaraOryza glumipatula93.5394.8998.72390forward

Expression of CNT30115607

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MGGFYCGLIKVGDSPAASVRLLRDFTCRTCSRCRSSCCRTCPTWSKI*

Sequence

>CNT30115607
GTTCGATTGAGTATGATAGACCTTTTTACTAGGCAAACCACACGAATACACGATTGATTAATTTCACTGAGAATAGCACGGGTACATCACATCACACAAA
TTCATACGTTGATACACGCATAGTCGCCGAAGCGACCAGCTGCTTAATTAATCGATAACACACGGGTTTAATTCAGCAATAATCAGCACACACACAAACC
ACACTCATATGGGTGGTTTTTATTGTGGACTAATTAAGGTAGGTGACTCGCCGGCGGCGAGTGTTCGGTTGCTTCGTGACTTCACTTGCCGCACTTGCAG
TCGGTGCAGGAGCAGCTGTTGCCGCACTTGTCCGACATGGTCGAAGATTTAATTAGCTAAGTGAGTGATGAGTTAATCCCTTGTGTTGCTTATGCTTTCT
TGTGCTCTGGTGGTGGT