Detailed information on CNT30115589


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LZI2|UXS2_ARATH, E-value = 1e-72

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522345Oryza nivaraSetaria italica17.3833.0789.92248forward
CNT30530404Oryza nivaraEucalyptus grandis24.1897.1884.93345forward
CNT30316147Oryza nivaraCorylus avellana25.5848.9982.74365forward
CNT30703138Oryza nivaraQuercus lobata17.1746.7682.45245forward
CNT30499549Oryza nivaraCoffea canephora11.6333.8881.93166forward
CNT3021362Oryza nivaraCitrullus lanatus12.7527.9679.12182forward
CNT30729539Oryza nivaraCorchorus capsularis15.5633.0478.83222forward
CNT3068683Oryza nivaraQuercus suber25.4473.7880.72363forward
CNT30524728Oryza nivaraPhaseolus vulgaris18.0147.5980.16257forward
CNT30506399Oryza nivaraNicotiana attenuata9.8142.380.71140forward
CNT30182233Oryza nivaraSecale cereale16.1236.9886.96230forward
CNT30289293Oryza nivaraTriticum aestivum10.4449.0186.58149forward
CNT30223417Oryza nivaraHordeum vulgare10.9368.7289.1156forward
CNT30590847Oryza nivaraMusa acuminata15.2147.4880.65217forward
CNT30539234Oryza nivaraBrassica napus18.0828.281.78258forward
CNT30145616Oryza nivaraMedicago truncatula11.2835.4680.75161forward
CNT30244810Oryza nivaraAvena sativa16.1928.5983.55231forward
CNT30261302Oryza nivaraBrassica rapa16.7546.2382.43239forward
CNT30454417Oryza nivaraSaccharum spontaneum26.4248.1590.98377forward
CNT30131528Oryza nivaraLolium perenne22.2168.7689.27317forward
CNT3066796Oryza nivaraLeersia perrieri16.1959.3886.15231forward
CNT30653881Oryza nivaraRosa chinensis25.8634.5580.49369forward
CNT30718631Oryza nivaraMalus domestica golden2664.6380.59371forward
CNT30339698Oryza nivaraEragrostis tef26.730.8590.29381forward
CNT30363710Oryza nivaraSorghum bicolor16.439.8692.74234forward
CNT30595456Oryza nivaraOryza meridionalis16.441.0587.18234forward
CNT30360575Oryza nivaraLactuca sativa17.3841.1379.84248forward
CNT30570592Oryza nivaraVitis vinifera16.8274.381.67240forward
CNT3055709Oryza nivaraAmborella trichopoda10.3722.6381.76148forward
CNT30105598Oryza nivaraOryza longistaminata37.3577.3697.94533forward
CNT30319856Oryza nivaraAsparagus officinalis18.7195.3682.77267forward
CNT30102778Oryza nivaraOryza rufipogon3.9922.5387.7257forward
CNT30574680Oryza nivaraOryza barthii61.1195.299.43872forward
CNT30580197Oryza nivaraEchinochloa crusgalli26.2845.5190.93375forward
CNT30499107Oryza nivaraDigitaria exilis17.3863.4389.11248forward
CNT30594668Oryza nivaraEragrostis curvula12.0551.0484.88172forward
CNT30603529Oryza nivaraOryza punctata26.4949.4196.3378forward
CNT30174824Oryza nivaraVigna angularis22.633479.88323forward
CNT30550386Oryza nivaraOryza brachyantha19.2710095.64275forward
CNT30337932Oryza nivaraCynara cardunculus17.6630.7380.16252forward
CNT3064271Oryza nivaraSelaginella moellendorffii14.4437.4580.1206forward

Expression of CNT30115589

Peptides detected in this lncRNA

>peptide 1 (44 aa)
KGLAVAVLLSNVKLKKMLLSLLLFDSSLILYCCHYFGKNYADLV*

>peptide 2 (39 aa)
MGALKIRTAQPQSPAFGIPASSPPFKKKKTNIYILNGSY*

>peptide 3 (37 aa)
MRRRRKGRRGRRGRRRGASRRGRRRGGARRRRSGRRG*

>peptide 4 (66 aa)
MGSTTSWRITSNRGLARWCATLSLRPVKKLSTTITLSPRSTRRSTRWLKVVVVVVAAEDEASEEGA*

Sequence

>CNT30115589
GGAAAGGGTTAGCTGTTGCAGTGTTGCTGTCAAATGTCAAGTTGAAGAAAATGCTCCTTTCTCTACTGTTGTTTGATTCTTCTCTAATTCTCTATTGCTG
TCACTATTTTGGAAAAAACTATGCTGACTTGGTGTAGTTTTTATCCTACTCTTCCCTTGTTAGCGAGGTATCCAACAAGTGGCTGACCCTCTCGGAGCTA
CTTCTACCAAGCAAAAGTGTAATCTTCTAAACGAAAGATTCAAAGCATGGGTGCCCTAAAAATTAGGACAGCCCAGCCACAATCCCCAGCATTTGGAATT
CCAGCCAGTAGCCCTCCTTTTAAAAAAAAAAAAACAAACATCTATATTCTCAACGGTTCATATTAGCAGTGGCTCCATATTACTATAGCTTTTCAAATCA
CAGGGTAATCCAATAATAGCTTATTTTTCTGTCAGTATTTTGATTCTTAGAAAAAATTTCTAGAACAAATAAACATAATTTTGTTGGTTTCTGTCCTACA
GTAAAATTATAAGAAATTAATACGGAGTATTGACAGCATAGGTGTTCCCATACTCTTATCTGTTATCCAACAAACAACTCAGTCCAAACATGAAAGGTAA
CTATTAAGTTAATTTGTCAGTTAAATGCTGAGACATTAAATAATATGGCAAACAAAATATTGGCAGAGAATTATTACCAATGGGGTTGACATTGCCCCAG
TAAGTCTCCACCTGAGGGTGCTGGAGGGGATCTCCATATACCTCACTGGTGCTGGTGAGGAGAAATTTTGCCCCAATCCTCTTGGCCAATCCAAGCATGT
TCAGTGTCCCAACCACGTTGGATATGATGGTCTTGATGGGGTTGTACTTGTAGTGCACGGGGCTAGCGGGGCAGGCGAGGTGGTAGATCTGGTCGACCTC
GAGCAGGATGGGCTCGACGACGTCGTGGCGGATCACCTCGAATCGCGGGTTGGCGAGGTGGTGCGCCACGTTGTCCTTGCGCCCCGTGAAGAAGTTGTCG
ACGACGATCACGCTGTCGCCGCGCTCCACCAGGCGGTCCACGAGGTGGCTGAAGGTGGTGGTGGTGGTGGTGGCGGCGGAGGATGAGGCGTCGGAGGAAG
GGGCGTAGAGGGAGAAGAGGGCGGCGGCGAGGAGCATCCCGGCGAGGGCGAAGGCGGGGCGGTGCTCGGCGGCGGCGTAGCGGGCGGCGCGGGTGAGCCA
GGAGAGCGGCTTGGAGGGCTTGGGGGAGTACTCCCCGCCGTCGGAGGCGGAGCCCGGGGCCCCCGCGCCGCCGCGGTACGTGAGCTCCGACGCCATCTCC
GGCGAACGTCTCAGATGTAGAAAAAAAAAAAGCTTCTCTCTCTCTCACTGAGACGTGGGACCCACGCCCCTATAATTGCGTGTAAGGACCAAGGACGAGA
GGTTGGAGAGTCAGATTTCTCTCCGCG