Detailed information on CNT30115514


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT000173, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690551Oryza nivaraOryza sativa90.9799.5498.61433reverse complement
CNT3099540Oryza nivaraOryza rufipogon85.7179.5398.53408forward
CNT30575020Oryza nivaraOryza barthii10060.198.53476forward

Expression of CNT30115514

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MVGGDGVSLDSGGDVVGGSWDESCAWMVNRVICRWILEEM*

>peptide 2 (78 aa)
GSGGRWDGGVNGEAARWMRAQQRLRDGGRRWGLAGLRWRCGGRIVGRVMRVDGEPCDLQVDPGRDVSRRSPPHNPNRS*

>peptide 3 (60 aa)
MTATRTSTSPIQICALAGARHLDRPPPWTSPPRPLPPSICSIHSFPRQATAASPESDSRR*

>peptide 4 (53 aa)
GKRGALGWRRKWGGGAVDASAAATEGWWAAMGSRWTPVEMWWEDRGTSHARGW*

>peptide 5 (41 aa)
MRLGRSSPPRPPTTVDLASSTAATLDLLHPQLPATSNRGVA*

Sequence

>CNT30115514
GGGAAGCGGGGGGCGCTGGGATGGAGGCGTAAATGGGGAGGCGGCGCGGTGGATGCGAGCGCAGCAGCGACTGAGGGATGGTGGGCGGCGATGGGGTCTC
GCTGGACTCCGGTGGAGATGTGGTGGGAGGATCGTGGGACGAGTCATGCGCGTGGATGGTGAACCGTGTGATCTGCAGGTGGATCCTGGAAGAGATGTGA
GCCGTCGCAGCCCTCCTCATAACCCGAACAGAAGCTAGACATCAAGACAATGACGGCGACGAGGACCTCGACCTCGCCCATCCAGATATGCGCCTTGGCA
GGAGCTCGCCACCTCGACCGCCCACCACCGTGGACCTCGCCTCCTCGACCGCTGCCACCCTCGATCTGCTCCATCCACAGCTTCCCGCGACAAGCAACCG
CGGCGTCGCCTGAGAGCGATTCACGGCGGTGACGACGCAGTGGCGCGGTGGCGGCGCGACGGTAGCCAAGGGCGAC