Detailed information on CNT30115513


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30344950Oryza nivaraEragrostis tef75.4374.7981.14175forward
CNT30106638Oryza nivaraOryza longistaminata10097.8999.14232forward
CNT3099490Oryza nivaraOryza rufipogon10049.05100232forward
CNT30575022Oryza nivaraOryza barthii10097.8999.57232forward

Expression of CNT30115513

Peptides detected in this lncRNA

>peptide 1 (40 aa)
PSETQLCSAHGASHRLAGRPYRQHTRLAAVAQTQHPFSPL*

>peptide 2 (29 aa)
LLKLSFAPLTALLIDWQEDHTDSILAWLR*

Sequence

>CNT30115513
ACCTTCTGAAACTCAGCTTTGCTCCGCTCACGGCGCTTCTCATCGATTGGCAGGAAGACCATACCGACAGCATACTCGCCTGGCTGCGGTAGCTCAAACC
CAGCATCCTTTCTCGCCTCTCTGAAAAAGTTATGCGGTAGAGCCACAAGGATGCCGGCACCATCGCCAGTGTTCTTCTCACAGCCGCAGGCACCACGGTG
CGCCATTCTCTCAAGCATCTCGAGGGCGTCAT