Detailed information on CNT30115511


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT001271, E-value = 2e-119

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30555423Oryza nivaraOryza glaberrima63.2760.4599.08217forward
CNT30578144Oryza nivaraOryza barthii63.2759.6299.08217forward

Expression of CNT30115511

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MLDGQLMSSSSRRRRRCRRWCKEKAPHTTPPGEVPLQESVIITPCCWPPF*

Sequence

>CNT30115511
GCACGGGATAGAGCTGCATTACAGCTTTAGCTAAGCTACACCAGCTCAACACTGAAGCAGCAGAAACATGCAATAATGGAACCTAAGGTACATCTATCAC
AGCTATCTGCGTGTGTAGATGGATGGATGGATACCTGAAAGTACTTGGAACAATGATGCAATGGTTGATGCTATGGCGGATGGATGCTTGATGGACAGTT
GATGTCGTCATCATCACGCCGCCGCCGCCGGTGCCGCCGGTGGTGCAAAGAAAAAGCTCCTCACACTACACCTCCAGGTGAAGTGCCTTTGCAGGAGAGT
GTGATCATCACACCATGCTGCTGGCCACCATTTTAAGGGCAGA