Detailed information on CNT30115464


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONORUT004092, E-value = 1e-88

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30115464

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MQILEFHIDSKEQMHGIPGSRKSMTWSFTKCYSISNENTTDV*

>peptide 2 (37 aa)
MISFDYSSLNESQTMLSNTNNSYSVYSIIPINRRIII*

>peptide 3 (34 aa)
MKIFTPYCKKQCRYLSFTLIARSRCTVSLVLGNP*

>peptide 4 (33 aa)
VCVDLRFLLVGAQLGLTQAYEDKACRAVHLAAE*

>peptide 5 (32 aa)
MYRPGIMIREDITIPPMRIMKFECWAKRRKIK*

Sequence

>CNT30115464
GTCTGTGTAGACTTGAGATTTCTTCTCGTGGGGGCTCAGCTGGGCCTCACTCAGGCTTACGAGGATAAGGCGTGCAGAGCGGTGCATTTGGCGGCCGAGT
AAGAGTGAGGATAAGGCATGTAGCATTCCATGGAAGGGAAGGGAAGCAAAGCATGGATTTGCGGCGATGATCGACGGACGGAAGGATTTCAATGTAGCAA
GTATCTCTGAATGATGTCAGGATGAAAATCTTTACACCATACTGCAAAAAACAATGCAGATACTTGAGTTTCACATTGATAGCAAGGAGCAGATGCACGG
TATCCCTGGTTCTAGGAAATCCATGACTTGGTCATTCACAAAATGCTACTCAATCTCAAACGAGAACACAACAGATGTATAGGCCTGGTATTATGATAAG
GGAGGACATTACAATACCACCTATGAGAATCATGAAGTTTGAGTGTTGGGCAAAGAGAAGAAAAATCAAGTAGCACAAAAGCAGCACGACCAAGTCCAGG
GGGAGCAATACCTATACTATATTAATGATGTGCATGAGATTGCAATATACTACGTACCTGTTAAGGTATGCTGGTTACCAAAATAAAAACTAGAGAAAAT
ACCATTCTTTTTTTGTTGAGATTTAAATTATTCAGATATATATGATTTCTTTCGATTATTCATCACTTAATGAATCCCAGACCATGCTGTCCAATACAAA
TAACTCTTATTCTGTATACAGCATAATTCCGATAAACAGAAGAATAATTATTTAATAAGTCAGGAAGTGTGGAAACA