Detailed information on CNT30113899


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH32|UBQ4_ARATH, E-value = 2e-69

BLAST vs NONCODE:
NONGMAT000502, E-value = 3e-71

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30379315Ficus caricaManihot esculenta55.655.4283.29700forward

Expression of CNT30113899

Peptides detected in this lncRNA

>peptide 1 (51 aa)
MHTSTETKDQMESRLLLDVVIGEGPAVLELLAGEIRRCWSGGSPPCLGSWP*

>peptide 2 (41 aa)
NTTFIYYKTKILIPSGSYSTKLKENIFVSFWFPSNQINRKH*

>peptide 3 (40 aa)
MVSELSTSRVMVLPVRVLTKICIFSEEFGERERDCWGREK*

>peptide 4 (63 aa)
MVSELSTSRVIYGPVRVFTNICIPPRSLSNQMQRRLLLDVVIGEGATVLPLLAGEDQPSAWSA*

Sequence

>CNT30113899
AAAACACAACCTTTATTTATTATAAAACGAAAATACTAATTCCATCTGGTTCATATTCAACAAAATTAAAAGAAAACATATTTGTTTCATTTTGGTTCCC
ATCGAACCAAATTAACAGAAAACATTAAAAAACAAACTTCTTTAAAACTTCCCACCACGAAGACGGAGGACAAGGTGGAGGGTAGACTCCTTCTGGATAT
TGTAATCAGCAAGGGTGCGACCATCCTCCAACTGCTTCCCGGCAAAGATCAGACGCTGCTGGTCCGGTGGAATCCCCTCCTTGTCCTGGATCTTCGCCTT
CACGTTGTCGATTGTGTCCGAGCTCTCAACCTCGAGGGTGATCGTCTTGCCAGTGAGGGTTTTCACAAAATCTGCATCCCTCCACGGAGACGGAGCACCA
GATGAAGAGTGCTTCCTTCTGTATGTTGTAGTCGGCTAGGGTTCGGCCGTCCTCGAGCTGCTTTCCGGCGAAGATAAGCCTCTGCTGGTCCGGGGGAATA
CCTTCCTTGTCCTGGATCTTGGCTTTCACGTTGTCGATGGTGTCGGAGCTCTCGACCTCAAGGGTGATCTACGGTCCGGTTAGGGTTTTCACAAATATCT
GCATACCACCGCGGAGCCTGAGTAACCAGATGCAGCGTCGACTCCTTCTGGATGTTGTAATCGGCGAGGGTGCGACCGTCCTCCCACTGCTTGCCGGCGA
AGATCAGCCCTCTGCTTGGTCCGCGTGATTCCTCCTTATCCTGGATCTTGGCCTTGACGTTGTCGATCGTGTCAGAGCTCTCGACTTCTAGGGTTATCGT
CTTACCGGTTAGGGTTTTGACGAAGATCATGCATACCTCCACGGAGACGAAGGACCAGATGGAGAGTAGACTCCTTCTGGATGTTGTAATCGGCGAGGGT
CCGGCCGTCCTCGAGCTGCTTGCCGGCGAGATCAGACGCTGCTGGTCCGGAGGATCCCCTCCTTGTCTTGGATCTTGGCCTTGACGTTGTCGATGGTGTC
GGAGCTCTCGACCTCGAGAGTGATGGCTTGCCGGTGAGGATCAGACGCTGCTGGTCCGGCGGGATTCCTTCCTTGTCCTGGATCTTGGCCTTGACGTTGT
CGATGGTGTCGGAGCTCTCGACCTCGAGAGTTATGGTCTTGCCGGTTAGGGTTTTGACGAAGATCTGCATATTTTCAGAGGAATTCGGAGAGAGAGAGAG
AGATTGTTGGGGGAGAGAGAAATGACGGAGGGGAAAGCATAGTTGTAAATAGAGTTAAT