Detailed information on CNT30113898


BLAST search results

BLAST vs Swiss-Prot:
sp|Q1EC66|UBQ3_ARATH, E-value = 2e-129

BLAST vs NONCODE:
NONMEST001181, E-value = 9e-81

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30113898

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MESALLLDVVVREGATVLKLFPGEDKPLLVRGNTFLVLDLRLHVVDGVGALNLQGDRLASEGFSQKSASLH*

>peptide 2 (40 aa)
MVSELSTSRVMVLPVRVLTKICIFSEEFGERERDCWGREK*

>peptide 3 (41 aa)
NTTFIYYKTKILIPSGSYSTKLKENIFVSFWFPSNQINRKH*

>peptide 4 (74 aa)
MVSELSTSKVIVLPVRGFHKNLHPSTETEHQMKSALLLDVVVGEGSAVPPAAFRRRSRRCWFRRNPFLILDLGP*

>peptide 5 (81 aa)
MVSELSTSRVIEYGPVRVFTNICIPPRSLSNQMQRRLLLDVVIGEDQTLLVRRDSFLVLDLGLDVVDGVGALDLESYGLAG*

Sequence

>CNT30113898
AAAACACAACCTTTATTTATTATAAAACGAAAATACTAATTCCATCTGGTTCATATTCAACAAAATTAAAAGAAAACATATTTGTTTCATTTTGGTTCCC
ATCGAACCAAATTAACAGAAAACATTAAAAAACAAACTTCTTTAAAACTTCCCACCACGAAGACGGAGGACAAGGTGGAGGGTAGACTCCTTCTGGATAT
TGTAATCAGCAAGGGTGCGACCATCCTCCAACTGCTTCCCGGCAAAGATCAGACGCTGCTGGTCCGGTGGAATCCCCTCCTTGTCCTGGATCTTCGCCTT
CACGTTGTCGATTGTGTCCGAGCTCTCAACCTCGAGGGTGATCGTCTTGCCCGTGAGGGTCTTGACAAAGATCTGCATTCCACCACGGAGACGGAGCACC
AGATGGAGAGTGCTCTCCTTCTGGATGTTGTAGTCCGCGAGGGTGCGACCGTCCTCAAGCTGTTTCCCGGCGAAGATAAGCCTCTGCTGGTCCGGGGGAA
TACCTTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCGGAGCTCTCAACCTCCAAGGTGATCGTCTTGCCAGTGAGGGGTTTTCACAAAAA
TCTGCATCCCTCCACTGAGACGGAGCACCAGATGAAGAGTGCTCTCCTTCTGGATGTTGTAGTCGGCGAGGGTTCGGCCGTCCCTCCAGCTGCTTTCCGG
CGAAGATCAAGACGCTGCTGGTTCCGGAGGAATCCCTTCCTTATCCTGGATCTTGGGCCTTGACGTTGTCGATGGTGTCGGAGCTCTCCACCTCCAGGGT
GATCGAGTACGGTCCGGTTAGGGTTTTCACAAATATCTGCATACCACCGCGGAGCCTGAGTAACCAGATGCAGCGTCGACTCCTTCTGGATGTTGTAATC
GGCGAGGATCAGACGCTGCTGGTCCGGCGGGATTCCTTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTCGGAGCTCTCGACCTCGAGAGTT
ATGGTCTTGCCGGTTAGGGTTTTGACGAAGATCTGCATATTTTCAGAGGAATTCGGAGAGAGAGAGAGAGATTGTTGGGGGAGAGAGAAATGACGGAGGG
GAAAGCATAGTTGTAAATAGAGTTAATTGCCCGTTT