Detailed information on CNT30113839


BLAST search results

BLAST vs Swiss-Prot:
sp|Q1EC66|UBQ3_ARATH, E-value = 2e-123

BLAST vs NONCODE:
NONMEST001181, E-value = 9e-81

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30513509Ficus caricaJuglans regia57.4881.8388.36653forward
CNT30630785Ficus caricaVigna unguiculata57.1376.0885.98649forward
CNT30228911Ficus caricaAnanas comosus65.1447.5386.76740forward

Expression of CNT30113839

Peptides detected in this lncRNA

>peptide 1 (55 aa)
MESALLLDVVVREGATVLKLFPGEDKPLLVRGNTFLVLDLRLHVVDGVGALNLQG*

>peptide 2 (74 aa)
MVSELSTSKGDRLAGEGFHKNLHPSTETEHQMKSALLLDVVVGEGSAVPPAAFRRRSRRCWFRRNPFLILDLGP*

>peptide 3 (81 aa)
MVSELSTSRVIEYGPVRVFTNICIPPRSLSNQMQRRLLLDVVIGEDQTLLVRRDSFLVLDLGLDVVDGVGALDLESYGLAG*

>peptide 4 (41 aa)
NTTFIYYKTKILIPSGSYSTKLKENIFVSFWFPSNQINRKH*

>peptide 5 (40 aa)
MVSELSTSRVMVLPVRVLTKICIFSEEFGERERDCWGREK*

Sequence

>CNT30113839
AAAACACAACCTTTATTTATTATAAAACGAAAATACTAATTCCATCTGGTTCATATTCAACAAAATTAAAAGAAAACATATTTGTTTCATTTTGGTTCCC
ATCGAACCAAATTAACAGAAAACATTAAAAAACAAACTTCTTTAAAACTTCCCACCACGAAGACGGAGGACAAGGTGGAGGGTAGACTCCTTCTGGATAT
TGTAATCAGCAAGGGTGCGACCATCCTCCAACTGCTTCCCGGCAAAGATCAGACGCTGCTGGTCCGGTGGAATCCCCTCCTTGTCCTGGATCTTCGCCTT
CACGTTGTCGATTGTGTCCGAGCTCTCAACCTCGAGGGTGATCGTCTTGCCCGTGAGGGTCTTGACAAAGATCTGCATTCCACCACGGAGACGGAGCACC
AGATGGAGAGTGCTCTCCTTCTGGATGTTGTAGTCCGCGAGGGTGCGACCGTCCTCAAGCTGTTTCCCGGCGAAGATAAGCCTCTGCTGGTCCGGGGGAA
TACCTTCCTTGTCCTGGATCTTCGCCTTCACGTTGTCGATGGTGTCGGAGCTCTCAACCTCCAAGGGTGATCGTCTTGCCGGTGAGGGTTTTCACAAAAA
TCTGCATCCCTCCACTGAGACGGAGCACCAGATGAAGAGTGCTCTCCTTCTGGATGTTGTAGTCGGCGAGGGTTCGGCCGTCCCTCCAGCTGCTTTCCGG
CGAAGATCAAGACGCTGCTGGTTCCGGAGGAATCCCTTCCTTATCCTGGATCTTGGGCCTTGACGTTGTCGATGGTGTCGGAGCTCTCCACCTCCAGGGT
GATCGAGTACGGTCCGGTTAGGGTTTTCACAAATATCTGCATACCACCGCGGAGCCTGAGTAACCAGATGCAGCGTCGACTCCTTCTGGATGTTGTAATC
GGCGAGGATCAGACGCTGCTGGTCCGGCGGGATTCCTTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTCGGAGCTCTCGACCTCGAGAGTT
ATGGTCTTGCCGGTTAGGGTTTTGACGAAGATCTGCATATTTTCAGAGGAATTCGGAGAGAGAGAGAGAGATTGTTGGGGGAGAGAGAAATGACGGAGGG
GAAAGCATAGTTGTAAATAGAGTTAATTGCCCGTTT