Detailed information on CNT30113588


BLAST search results

BLAST vs Swiss-Prot:
sp|Q75KD7|AOC_ORYSJ, E-value = 4e-84

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692141Ficus caricaOryza sativa32.1730.2584.73203forward
CNT30552977Ficus caricaOryza glaberrima32.1730.384.73203forward
CNT30611156Ficus caricaArabis alpina17.9137.9282.3113forward
CNT30132965Ficus caricaLolium perenne29.7940.9682.98188forward
CNT301476Ficus caricaZea mays13.1525.390.3683forward
CNT30231426Ficus caricaAnanas comosus28.3722.883.8179forward
CNT30345256Ficus caricaEragrostis tef38.1946.8982.99241forward
CNT30361694Ficus caricaSorghum bicolor13.4738.4690.5985forward
CNT30595924Ficus caricaOryza meridionalis32.1741.9485.71203forward
CNT3028475Ficus caricaTheobroma cacao17.4323.8681.82110forward
CNT30101081Ficus caricaOryza rufipogon32.1716.6784.73203forward
CNT30116289Ficus caricaOryza nivara32.1725.9684.73203forward

Expression of CNT30113588

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MASYRSPFFSGTCLISTQRPVVMPSRFSKSPREFTCFWLSLRNAGLPLSRSLIS*

>peptide 2 (37 aa)
MTASLSFALAAGDGSMSGEGSTCLPRSSLGKSGIPLR*

Sequence

>CNT30113588
TTTTCTTTCGGCCTCAATTGAGTCATAAACAAGAAATTACACAATTTACTAGCGAACATAATTAAGGTAAACTCACAAAACACATCTCACGAAGATAAAC
ACATAAAATTCACCTAATTAATCACTTTTTCTCCTTATGATCAGTCAGTGAAGTTAGGAATGACGGCGTCGCTCTCCTTCGCCTTGGCGGCCGGAGACGG
CTCGATGTCCGGGGAAGGGTCCACGTGCTTGCCGAGAAGCTCCTTGGGCAAATCAGGGATACCCTTGAGGTAAAACGTGTAGAAGAGCTTGAAGGGGAAG
ATGAGCTGCTGAAGCTTGACTTGTCCGTACACTCCCTGGAAGATTCCGGAACCTCCGGTGACGGCTAAGTACGTATCCTGGTACGTCAGGTACGGCCCTT
GGACGGAGATGTGGCCGTAGTCGCCGAAGTAGAAGCTGTAGATGGCCTCGTACCGGTCTCCTTTCTTCTCGGGGACGTGTTTGATCAGCACGCAGAGGCC
GGTGGTTATGCCGAGCCGCTTCTCCAAGTCGCCGAGAGAATTCACCTGCTTCTGGCTCAGCTTAAGAAATGCTGGGCTTCCTCTGTCTCGCTCGTTGATC
TCGTAGACCCGAAGCTCTTGGACTTTCGCTA