Detailed information on CNT3011335


BLAST search results

BLAST vs Swiss-Prot:
sp|P27497|CB29_MAIZE, E-value = 3e-163

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696036Zea maysOryza sativa58.0865.692.58593forward
CNT30522251Zea maysSetaria italica55.8376.6188.6570forward
CNT30554891Zea maysOryza glaberrima68.5658.7292.29700forward
CNT30473163Zea maysSaccharum spontaneum77.3867.2392.41790forward
CNT30369254Zea maysOryza glumipatula56.0255.4393.88572forward
CNT30103296Zea maysOryza rufipogon68.5675.5992.14700forward
CNT30582453Zea maysEchinochloa crusgalli54.2652.2692.24554forward

Expression of CNT3011335

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MAQREWITSSSRFLANVSGSADSPAVSQP*

>peptide 2 (63 aa)
MWSARFSSGPFPVTMAWTKNPNMENMARRPFLSSLTLSSAKASGSSARPSGSKLPPGGPPAMR*

>peptide 3 (49 aa)
TPDLDKIGRNEKERGKIMTMNTIIPCRLNNSLHHGTNRKPACAHMHPDT*

>peptide 4 (33 aa)
MVQTENQRALTCIRTPKGHRRRLPHLPGTKLVA*

Sequence

>CNT3011335
AAACACCTGATTTAGATAAAATCGGCAGGAACGAAAAAGAGAGGGGAAAAATAATGACAATGAACACAATTATTCCTTGTCGATTGAACAATAGTTTACA
TCATGGTACAAACCGAAAACCAGCGTGCGCTCACATGCATCCGGACACCTAAAGGTCACCGGCGGCGCCTCCCTCACTTGCCGGGGACGAAGTTGGTGGC
GTAGGCCCAAGCGTTGTTGTTGACGGGGTCGGCAATGTGGTCAGCGAGGTTCTCGAGCGGGCCCTTCCCGGTGACGATGGCCTGGACGAAGAATCCGAAC
ATGGAGAACATGGCGAGGCGGCCGTTCTTGAGCTCCTTGACCTTGAGCTCGGCGAAGGCCTCGGGGTCGTCGGCGAGGCCGAGCGGGTCGAAGCTGCCGC
CGGGCGGGCCGCCGGCGATGCGGTAGCCCTCGACGGCGCCCATGAGCACGACCTGGCAGGCCCAGATGGCAAGGATGCTCTGCGCGTGGATGAGGCTCGG
GTTCCCGAGGTAGTCCAGCCCGCCCTCGCTGAAGATCTGGGAGCCGGCCTTGAACCACACGGCCTCGCCGAACTTGACGCCGTTGCGGGCGAGAAGCTCC
GGGAAGACGCAGCCGAGCGCGCCCAGCATGGCCCAGCGGGAGTGGATCACCTCCAGCTCCCGGTTCTTGGCGAACGTCTCCGGGTCCGCCGACAGCCCCG
CGGTGTCCCAGCCGTAGTCGCCCGGGAACTCGCCCGTCAGGTAGCTCGGCGGCTCGCCGGACAGTGGGCCCAGGTACAGCACGCGGTCGGGGCCGTACCA
CGGGCTCCCGGACGCCGCCGCTGGCTTGGCCTTCGCCGCCGTCTTGCGCATCGTCACGCGGGCCTCGCCGAAGGCGGACGACGACGGCACGTTCACGGCC
TTGCCGGCGAAGGCCGTGGAGGAGAGGGCCATGGTGCTGCTCGCCATTGCGGCTGCTTTTTTTATTGCACTGCTACGTAGCGAGACTTGCAGATCGATGG
TGGCTTGAGATGCTGTGGACT