Detailed information on CNT30113329


BLAST search results

BLAST vs Swiss-Prot:
sp|Q307Y9|METK1_SOLTU, E-value = 3e-126

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673027Ficus caricaSetaria viridis38.0764.0686.59410forward
CNT30520816Ficus caricaSetaria italica20.825.9387.5224forward
CNT30641080Ficus caricaNymphaea colorata23.2127.9382.8250forward
CNT30549537Ficus caricaIpomoea triloba18.8530.4884.24203forward
CNT30515028Ficus caricaJuglans regia22.1928.1582.01239forward
CNT30698521Ficus caricaQuercus lobata16.1631.0285.63174forward
CNT30373104Ficus caricaArabidopsis thaliana35.5645.6584.33383forward
CNT30618114Ficus caricaSesamum indicum16.940.2782.42182forward
CNT30266631Ficus caricaChenopodium quinoa18.3822.687.88198forward
CNT3021108Ficus caricaCitrullus lanatus26.2817.1988.34283forward
CNT30729048Ficus caricaCorchorus capsularis12.4420.4386.57134forward
CNT30381524Ficus caricaManihot esculenta41.3253.8185.84445forward
CNT30402686Ficus caricaBeta vulgaris37.7967.584.28407forward
CNT30524807Ficus caricaPhaseolus vulgaris18.7622.984.65202forward
CNT30628558Ficus caricaVigna unguiculata18.4823.7585.93199forward
CNT30712616Ficus caricaGlycine max26.0934.5684.34281forward
CNT3047443Ficus caricaPrunus dulcis20.7118.6985.2223forward
CNT30638840Ficus caricaCapsicum annuum18.3823.1986.87198forward
CNT3090332Ficus caricaSolanum tuberosum16.0626.6287.28173forward
CNT30188757Ficus caricaSecale cereale20.2449.2186.7218forward
CNT30292894Ficus caricaTriticum aestivum14.326.8890.91154forward
CNT30225924Ficus caricaHordeum vulgare14.2127.1890.85153forward
CNT30389985Ficus caricaTriticum turgidum26.2827.8386.57283forward
CNT30172560Ficus caricaTrifolium pratense21.4533.9283.98231forward
CNT30144304Ficus caricaMedicago truncatula26.2844.0184.45283forward
CNT30441436Ficus caricaAegilops tauschii20.5243.5987.78221forward
CNT3059692Ficus caricaArabidopsis lyrata8.5431.8388.0492forward
CNT30471290Ficus caricaSaccharum spontaneum19.7823.7287.79213forward
CNT3013982Ficus caricaZea mays15.7858.6288.82170forward
CNT30608385Ficus caricaGossypium raimondii11.8823.2782.81128forward
CNT30218668Ficus caricaKalanchoe fedtschenkoi19.4154.0185.65209forward
CNT3066706Ficus caricaLeersia perrieri10.9634.7183.9118forward
CNT30650282Ficus caricaRosa chinensis20.6118.8586.04222forward
CNT30624603Ficus caricaDaucus carota20.6133.6486.04222forward
CNT30686785Ficus caricaTriticum urartu20.5221.8888.69221forward
CNT30349162Ficus caricaEragrostis tef20.5224.2686.88221forward
CNT30477100Ficus caricaArabidopsis halleri9.1925.0686.8799forward
CNT30367875Ficus caricaSorghum bicolor16.3421.2888.07176forward
CNT30597163Ficus caricaOryza meridionalis17.2731.3187.63186forward
CNT30429132Ficus caricaPapaver somniferum25.8117.5378.78278forward
CNT30570759Ficus caricaVitis vinifera21.2640.7584.72229forward
CNT3055164Ficus caricaAmborella trichopoda20.0618.7885.19216forward
CNT3035650Ficus caricaCucumis melo2620.7786.79280forward
CNT30101941Ficus caricaOryza rufipogon16.4321.285.88177forward
CNT30116792Ficus caricaOryza nivara12.1620.3787.02131forward
CNT30174546Ficus caricaVigna angularis19.8727.9782.24214forward
CNT30551132Ficus caricaOryza brachyantha7.821.7692.8684forward
CNT30725315Ficus caricaLupinus angustifolius26.3728.2385.56284forward

Expression of CNT30113329

Peptides detected in this lncRNA

>peptide 1 (63 aa)
MTKRPEGFRWKMVFSSRYFSGMTGLITCSLRSAAISSFVTVSSCCVEIKTVCTRIGTLAPLSL*

>peptide 2 (96 aa)
MLLEVSSNLVICNGLIVLCGDQDSVHTDWNPGSIVVVIFHCDLGLAISSELGCKDMAERHELRGFIGGITKHVTLVTGTNLLRALSKVAVDTLSNIR

Sequence

>CNT30113329
TCCACAGACATAACAGTTTGATCAACTCATGTGAACGCTAGAGAGAGAGATTCAGATAATTCAAACAAATATTTTGTTTTTGCTTTTGTTTTTTAATAAG
GAAACACATTATAGGATCTGCTGTTGCTACTAAGTACCAGTGTCGTCGATTTGGGCAAAACTATGTTCATTACAGAGACACTGGGAACAAGATTCCATGA
AAATGAAATTAGGGGAAAAGTAAAAAAAGAAAAGAAAAAGGGCAAATAGAAACAACAGAGAAGAGCGTCTTCAGTATGATATTAGGACATTTTTAGCTAT
TGCGTCTAGATTATGGAAGAGCAGCAGCAGCAGTAGCAAAGAAACACGCGAATTATTTAAAAATCCAGTACCAAATGTAGTAAAAAGGCATCCAACAGCA
GCGACTGGTGATGATATTCTACTCTCCAACAACATTTAAGACTGGGGATTCTCCCACTTGAGGGGCTTCACAACCTCCCAAGTGAAGTCAGGGTCGTCCC
TTCCGAAGTGTCCGTAGGCCGCTGTCTTGAGGAACCTGCCGTTGCCTCCTCTCTTCAAGTCCAAGTTGATGGTGATCATTCCGGGCCTGAAGTCGAAGTT
TTCTTTCACGATCTTGAGGATCTCTTTGTCGGGGATCTTTCCGGTTCCATAGGTGTCGATGATGATCTTGCGCCCGGTGAGACCTGCATCACCGTGAGGG
CCACCAATGACAAAGCGGCCTGAGGGGTTCAGGTGGAAGATGGTTTTCTCGTCGAGGTACTTCTCAGGGATGACAGGCTTGATCACATGCTCCTTGAGGT
CAGCAGCAATCTCGTCATTTGTAACGGTCTCATCGTGCTGTGTGGAGATCAAGACAGTGTGCACACGGATTGGAACCCTGGCTCCATTGTCGTTGTGATA
TTCCACTGTGACTTGGGTCTTGCCATCAGCTCCGAGCTTGGTTGCAAGGACATGGCTGAGAGGCATGAGCTCAGGGGTTTCATCGGTGGCATAACCAAAC
ATGTGACCCTGGTCACCGGCACCAATCTCCTCAGGGCGCTTAGTAAAGTGGCCGTGGACACCCTGAGCAATATCAGG