Detailed information on CNT30113122


BLAST search results

BLAST vs Swiss-Prot:
sp|Q03033|EF1A_WHEAT, E-value = 3e-111

BLAST vs NONCODE:
NONBNAT007048, E-value = 6e-115

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30691950Ficus caricaOryza sativa58.9231.0585.89489forward
CNT30677701Ficus caricaSetaria viridis59.2871.8286.79492forward
CNT30521302Ficus caricaSetaria italica58.1932.7987.78483forward
CNT30639730Ficus caricaNymphaea colorata46.6342.1184.75387forward
CNT30535563Ficus caricaEucalyptus grandis59.2860.2986.18492forward
CNT30316757Ficus caricaCorylus avellana59.2841.0786.38492forward
CNT30546799Ficus caricaIpomoea triloba59.2840.0784.76492forward
CNT30518094Ficus caricaJuglans regia58.0751.585.48482forward
CNT30371709Ficus caricaArabidopsis thaliana55.6671.7485.5462forward
CNT30618435Ficus caricaSesamum indicum41.9370.8885.34348forward
CNT30274113Ficus caricaChenopodium quinoa46.6362.0287.34387forward
CNT3021235Ficus caricaCitrullus lanatus58.5569.3384.36486forward
CNT30727585Ficus caricaCorchorus capsularis58.1935.8387.99483forward
CNT30380145Ficus caricaManihot esculenta59.2826.1384.76492forward
CNT30525464Ficus caricaPhaseolus vulgaris47.2369.3884.18392forward
CNT30629525Ficus caricaVigna unguiculata46.5189.7784.97386forward
CNT30505987Ficus caricaNicotiana attenuata29.474.1685.25244forward
CNT30160120Ficus caricaPistacia vera59.439.6686.82493forward
CNT30287202Ficus caricaTriticum aestivum44.150.984.97366forward
CNT30224987Ficus caricaHordeum vulgare31.3388.1486.15260forward
CNT30387246Ficus caricaTriticum turgidum55.940.3187.72464forward
CNT30564256Ficus caricaActinidia chinensis59.2842.2786.99492forward
CNT3084148Ficus caricaVigna radiata56.9929.0483.51473forward
CNT30541587Ficus caricaBrassica napus53.7337.9385.87446forward
CNT30234210Ficus caricaBrassica oleracea58.1943.8784.89483forward
CNT30509929Ficus caricaSolanum lycopersicum18.1970.5690.73151forward
CNT30173274Ficus caricaTrifolium pratense59.2836.5884.55492forward
CNT30146334Ficus caricaMedicago truncatula40.4833.885.42336forward
CNT30439068Ficus caricaAegilops tauschii27.4741.5386.84228forward
CNT30246955Ficus caricaAvena sativa56.2726.4685.44467forward
CNT30665783Ficus caricaTriticum dicoccoides50.646.185.24420forward
CNT30310177Ficus caricaCamelina sativa59.2842.4184.35492forward
CNT3059230Ficus caricaArabidopsis lyrata59.2840.9384.96492forward
CNT3079066Ficus caricaBrassica juncea58.0740.3784.85482forward
CNT30598511Ficus caricaFraxinus excelsior42.4154.0789.77352forward
CNT30449969Ficus caricaSaccharum spontaneum59.439.0686493forward
CNT30132437Ficus caricaLolium perenne56.3938.9484.4468forward
CNT3011166Ficus caricaZea mays59.434.8785.8493forward
CNT30608730Ficus caricaGossypium raimondii43.9860.8385.75365forward
CNT30232362Ficus caricaAnanas comosus31.8146.2385.98264forward
CNT30651330Ficus caricaRosa chinensis28.9254.4288.33240forward
CNT30203418Ficus caricaHelianthus annuus25.1851.185.65209forward
CNT30127375Ficus caricaCorymbia citriodora46.7569.5386.6388forward
CNT30624959Ficus caricaDaucus carota37.2390.8882.2309forward
CNT30685098Ficus caricaTriticum urartu50.628.5785.24420forward
CNT30350898Ficus caricaEragrostis tef58.9243.985.48489forward
CNT30480841Ficus caricaArabidopsis halleri46.8762.6485.6389forward
CNT30368770Ficus caricaSorghum bicolor59.468.8585.4493forward
CNT30355521Ficus caricaLactuca sativa56.2748.9584.15467forward
CNT30151899Ficus caricaPrunus persica36.7527.6586.23305forward
CNT30427756Ficus caricaPapaver somniferum59.2837.7383.94492forward
CNT30706337Ficus caricaPrunus avium54.9439.1186.18456forward
CNT3052982Ficus caricaAmborella trichopoda35.6622.6386.49296forward
CNT3024315Ficus caricaPopulus trichocarpa47.7151.986.11396forward
CNT3037774Ficus caricaCucumis melo50.2453.9588.49417forward
CNT30100761Ficus caricaOryza rufipogon41.0859.5186.22341forward
CNT30580076Ficus caricaEchinochloa crusgalli35.1822.0786.3292forward
CNT30496874Ficus caricaDigitaria exilis58.1943.0986.75483forward
CNT30594462Ficus caricaEragrostis curvula58.1941.4985.92483forward
CNT30603788Ficus caricaOryza punctata58.9241.5185.28489forward
CNT30176122Ficus caricaVigna angularis50.4837.0184.01419forward
CNT30724026Ficus caricaLupinus angustifolius59.1634.184.32491forward
CNT3050294Ficus caricaCucumis sativus59.2880.2682.93492forward

Expression of CNT30113122

Peptides detected in this lncRNA

>peptide 1 (39 aa)
PTHPTAATACQAPNSEHKERPANTCNNLNDRNKQDSNQN*

>peptide 2 (44 aa)
MMMTWAVKLAASLAGSSLEFEATKPRLRSLTATFLTLNPTLSPG*

Sequence

>CNT30113122
CCGACTCACCCAACTGCGGCCACCGCCTGTCAAGCACCCAATTCTGAGCACAAGGAAAGGCCAGCGAACACATGTAACAACTTAAACGACCGAAACAAAC
AAGACTCAAACCAAAACTGACTACTAAACGACTCAAAACGACACAACTTAAATAAACCAAGTCTTTAGGACGACGACGATAATAAAACCATAAACAGCAC
GAGTTCCACAATGCTTCAATCAACAAGAAAATCTCGTACCAAGAGGCCAGTCACTTCCCCTTCTTGGCAGCAGATTTGGTCACCTTAGCTCCACTTGGGT
CCTTCTTCTCCACGTTCTTGATGACACCGACGGCAACGGTGTGGCAGTCGAGGACCGGGGCATAGCCATTGCCGATCTGGCCGGGGTGGTTCATGATGAT
GACCTGGGCTGTGAAGTTGGCAGCCTCCCTGGCAGGGTCGTCCTTGGAGTTCGAGGCGACGAAACCACGCTTGAGATCCTTGACAGCAACGTTCTTAACA
TTGAACCCAACGTTGTCACCGGGGTGAGCCTCCAGGAGAGCCTCGTGGTGCATCTCAACGGACTTAACTTCAGTGGTCAGTCCGGTGGGTCCGAAAGTGA
CGACCATACCGGGCTTGATGATACCAGTCTCAACACGACCGACAGGGACAGTTCCAATACCACCGATCTTGTAGACGTCCTGGAGTGGGAGACGGAGGGG
CTTGTCCGAGGGCCTCTTGGGCTCCTGAATCTGGTCGAGGGCGTCCAGGAGGGTTGGACCCTTGTACCAGTCGAGGTTGGTAGACCTCTCAATCATGTTG
TCACCTTCGAAACCGGAGATCGGAACAAAG