Detailed information on CNT30113105


BLAST search results

BLAST vs Swiss-Prot:
sp|P32869|PSAD_CUCSA, E-value = 1e-101

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30695521Ficus caricaOryza sativa39.541.2587.34316forward
CNT30678303Ficus caricaSetaria viridis19.543.8288.46156forward
CNT30522550Ficus caricaSetaria italica34.1257.3586.81273forward
CNT30639185Ficus caricaNymphaea colorata34.3864.485.45275forward
CNT30515273Ficus caricaJuglans regia47.7559.5982.98382forward
CNT30376473Ficus caricaArabidopsis thaliana44.550.7180.06356forward
CNT30380094Ficus caricaManihot esculenta42.3831.3980.83339forward
CNT30403648Ficus caricaBeta vulgaris28.7520.7480.43230forward
CNT30525887Ficus caricaPhaseolus vulgaris12.6227.0183.17101forward
CNT30630888Ficus caricaVigna unguiculata34.6240.9283.75277forward
CNT30710333Ficus caricaGlycine max48.8844.9484.91391forward
CNT3094391Ficus caricaSolanum tuberosum22.8841.8881.97183forward
CNT30122581Ficus caricaPhyscomitrium patens1921.5679.61152forward
CNT30297782Ficus caricaTriticum aestivum21.536.4484.88172forward
CNT30395090Ficus caricaTriticum turgidum37.527.9183300forward
CNT3089114Ficus caricaVigna radiata37.1230.8780.13297forward
CNT30554655Ficus caricaOryza glaberrima39.536.1187.34316forward
CNT30145708Ficus caricaMedicago truncatula25.1226.183.58201forward
CNT30440464Ficus caricaAegilops tauschii37.536.1483.33300forward
CNT30246994Ficus caricaAvena sativa3836.4185.2304forward
CNT30665756Ficus caricaTriticum dicoccoides32.2536.3483.72258forward
CNT3061459Ficus caricaArabidopsis lyrata43.7559.7380350forward
CNT30611231Ficus caricaArabis alpina22.2530.9679.21178forward
CNT30446699Ficus caricaSaccharum spontaneum29.2526.0988.89234forward
CNT30971Ficus caricaZea mays34.6248.687277forward
CNT30228866Ficus caricaAnanas comosus27.6225.2985.52221forward
CNT30651207Ficus caricaRosa chinensis28.6233.8387.34229forward
CNT30344027Ficus caricaEragrostis tef3837.6285.86304forward
CNT30477818Ficus caricaArabidopsis halleri22.7538.8979.12182forward
CNT30361538Ficus caricaSorghum bicolor30.8850.9388.66247forward
CNT30619829Ficus caricaCajanus cajan53.7543.6184.19430forward
CNT30596794Ficus caricaOryza meridionalis24.3829.4188.72195forward
CNT30356274Ficus caricaLactuca sativa43.1252.9182.32345forward
CNT30370811Ficus caricaOryza glumipatula39.539.9587.34316forward
CNT30410573Ficus caricaPapaver somniferum24.521.882.65196forward
CNT30570681Ficus caricaVitis vinifera3017.5686.67240forward
CNT3035037Ficus caricaCucumis melo12.2532.6782.6598forward
CNT30148662Ficus caricaBrachypodium distachyon35.6237.0183.16285forward
CNT30577354Ficus caricaOryza barthii39.538.4487.34316forward
CNT30579362Ficus caricaEchinochloa crusgalli40.6237.2787.08325forward
CNT30117312Ficus caricaOryza nivara39.540.187.34316forward
CNT30174623Ficus caricaVigna angularis34.6232.5184.48277forward
CNT30725909Ficus caricaLupinus angustifolius25.8736.8386.96207forward
CNT3049718Ficus caricaCucumis sativus34.7553.2681.29278forward

Expression of CNT30113105

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MNLFSDMQRQQITSKRVSKFFHIVHDDHHSKSHYKPQN*

>peptide 2 (36 aa)
YTKKLNKHIYTDESVFGYAKTTNYKQKGKQIFPHST*

>peptide 3 (34 aa)
MGLTFFPMDLKFRPTPSRPGLTFSGYTPSLGCKY*

Sequence

>CNT30113105
TACACCAAGAAATTAAACAAACATATATATACCGATGAATCTGTTTTCGGATATGCAAAGACAACAAATTACAAGCAAAAGGGTAAGCAAATTTTTCCAC
ATAGTACATGATGATCATCACAGTAAATCACATTACAAACCACAAAATTAACCCCTTAATCCGACCATAATCAACATTATCAATTAATCTTCTTACAAAT
CATAGGGTTGTTTCCCAGTAAACTTGACCTCAATGGGGCTAACATTCTTCCCAATGGACCTAAAGTTCAGGCCGACACCTTCGCGTCCCGGGTTGACCTT
CTCCGGGTACACGCCGTCCTTGGGGTGCAAGTACTGAACCTCACCATTAGGGAACACCCTGTAGAACTGGTACTTGATCTTGTACTTGGACCGCAGCCTG
GTCCCCAGCGCCAGGCACTGCTCCTTCCTGGCCAGCTTCAGTAGGTTCGGGCCCTGCCGCATGATGGCTGCGCCGCCGGTCGGCATCTCGAAGATCTGCT
CCTTCGGGGAGTCCCACGTTATGACGTAGAACTCCTCCACCTGCGCCTTCCTTAGCAGCCCTCCCGTGCTGCCCCCGAATATCGGCGACGGCGTGCTGGG
GTCCAGCGCCGGGGGTGTGAACCCAACCGGGGCGGCTGCCTTGGCCTCGGAGGAGGTGAGGGACTGCTTCCACGGGACGGAGACTGCGCGGTCGCCGGAC
TTGGGGCGGAGGAGAGGGTTGGGGTGAAGAGGGTGGTGGTGGCTTGGGTCGCCATGGCCATTTGGAGATAATGGTAATGTGGGAGATTTGTGTTGTTGTG