Detailed information on CNT3011199


BLAST search results

BLAST vs Swiss-Prot:
sp|P47815|IF1A_WHEAT, E-value = 6e-67

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673634Zea maysSetaria viridis26.4773.8394.94158forward
CNT30521379Zea maysSetaria italica64.6661.4694.56386forward
CNT30631858Zea maysVigna unguiculata30.4940.6287.36182forward
CNT30708734Zea maysGlycine max39.0341.1784.98233forward
CNT30304884Zea maysTriticum aestivum32.6642.393.33195forward
CNT3074265Zea maysBrassica juncea33.530.3581.5200forward
CNT30474933Zea maysSaccharum spontaneum64.1560.797.91383forward
CNT30718760Zea maysMalus domestica golden18.0929.3585.19108forward
CNT30368761Zea maysSorghum bicolor63.6520.697.37380forward
CNT30619918Zea maysCajanus cajan36.189.6987.04216forward
CNT30595805Zea maysOryza meridionalis29.1540.6586.21174forward
CNT30573246Zea maysVitis vinifera43.0535.4585.21257forward
CNT30102311Zea maysOryza rufipogon39.735.4391.56237forward
CNT30576889Zea maysOryza barthii35.1832.0690.48210forward

Expression of CNT3011199

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MAEAARAIDADGLAPPVAEHPGHLRVLLPVFLEDELALV

>peptide 2 (54 aa)
MSPAAIQTFLCILPRIWQRRRVPSTQMASHRPLPSIRVTCAYSCPSSLKTSSRLS

Sequence

>CNT3011199
GGGTCTAATTGGCAAATCAATCAAGACAGGAGAACACAATTCAGAACAATAATAGCTTAGTACAGAACACCTTGTAACAGCATGTACCAGATTAAAAACG
AAATTACCCACGATTATTTAACCACTTCAGATCCTTTTACAAGATAACCCAGGCTAAACCATACCACAACATACCAGTACACGTCACGTAACAATAAAGG
TAGCCGTAAGCAGGAACAGATTTCTTAGATCTTGTCGATGTCCTCGTCCTCGAACTGGATGTAGTCGCTGCCCTCCTCGCCTTCCTCGGGCCCATCGACG
TCGACGCCCTCGTTGAGCCTGAGCGTGTCAGGAAGCTCCCCGTAGGCCTTGAGCAGGCGCGCCTCGTCGTTCATGTACTTGAGGATAACGTCGGCCTTGT
CGTCCTGGTAGTCGCGGAGGCCGACGAGGACGATGTCCCCAGCCGCGATCCAGACCTTCTTGTGCATCTTACCCCGGATATGGCAGAGGCGGCGCGTGCC
ATCGACGCAGATGGCCTCGCACCGCCCGTTGCCGAGCATCCGGGTCACCTGCGCGTACTCCTGCCCGTCTTCCTTGAAGACGAGCTCGCGCTTGTCG