Detailed information on CNT30111662


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CG84|UBI4P_NICSY, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30500348Ficus caricaCoffea canephora62.0655.7583.08839forward
CNT30728102Ficus caricaCorchorus capsularis67.3860.4582.22911forward
CNT30379426Ficus caricaManihot esculenta64.0574.7883.37866forward
CNT30526024Ficus caricaPhaseolus vulgaris67.969.3985.62918forward
CNT30506305Ficus caricaNicotiana attenuata50.5972.5385.67684forward
CNT30709517Ficus caricaGlycine max66.4996.7783.54899forward
CNT3044330Ficus caricaPrunus dulcis62.5769.1785.46846forward
CNT3086353Ficus caricaVigna radiata72.0445.4583.47974forward
CNT30171101Ficus caricaTrifolium pratense65.9853.6483.63892forward
CNT30418079Ficus caricaPapaver somniferum65.1668.0883.2881forward
CNT3032244Ficus caricaTheobroma cacao67.3879.2983.21911forward
CNT3024139Ficus caricaPopulus trichocarpa65.1682.0383.2881forward
CNT30326890Ficus caricaAsparagus officinalis67.3873.8284.3911forward
CNT30726149Ficus caricaLupinus angustifolius67.3847.8583.21911forward

Expression of CNT30111662

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MVFPVRVLTKICIPPRRRRTRCSVDSFWML*

>peptide 2 (48 aa)
QNENISIIWEHEYDINPTTYNLVKARSRATQVIIYIYIYMSYVCVCVD*

>peptide 3 (60 aa)
MSLCWSGGMPSLSWILALTLSIVSELSTSRVMVFPVRVLTNICIPPRRRRTKWRVDSFWML

>peptide 4 (53 aa)
MPSLSWILALTLSIVSELSTSKVMVFPVRVLTKICIPPRRRRTKWRVDSFWML*

Sequence

>CNT30111662
AGCAAAATGAAAACATAAGTATAATTTGGGAGCACGAATACGACATTAATCCAACTACTTATAACCTTGTAAAAGCCAGAAGCAGAGCAACACAGGTCAT
TATATATATATATATATATATGTCCTATGTGTGTGTGTGTGTGGATTAAACCAGATAGATGAACTAGAAAGAACACGTACCAAAGCATAACAACGAAAGG
AAATACTGTACTTGTATTGAGAAAGAAAAAACGCAAGTTCATTATTCACAGGCCTCGCAAGGGCCAAACTTAACCACGAAATTCAGTTCACACATATTAA
TAATATCCATAAGAACAAGAAGGCAGTAACACGGCGTCAAGCCTTCAAAACAGAGCAAACATCCTTAAAAGGAAAGTCACTTAAAAGCCACCACGAAGAC
GGAGGACAAGGTGAAGGGTGGACTCCTTCTGAATGTTGTAATCAGCCAAAGTCCTTCCATCCTCCAACTGCTTCCCTGCAAAAATCAACCTCTGCTGGTC
TGGCGGGATGCCCTCCTTGTCCTGAATTTTCGCCTTCACATTGTCGACAGTGTCCGAGCTCTCCACCTCCAAGGTGATCGTCTTCCCAGTCAAGGTCTTC
ACGAAGATCTGCATGCCACCCCTCAGGCGCAGCACAAGGTGAAGGGTGGACTCCTTTTGAATGTTGTAGTCGGCCAGGGTCCTTCCATCCTCAAGCTGCT
TCCCAGCGAAGATAAGCCTCTGCTGGTCTGGTGGGATGCCCTCCTTGTCCTGGATCTTAGCCTTGACATTGTCAATCGTGTCAGAGCTTTCAACTTCCAA
GGTAATGGTCTTTCCCGTAAGGGTCTTGACAAAGATCTGCATACCACCACGGAGGCGGAGGACCAAGTGGAGGGTCGACTCTTTTTGGATGTTGTAGTCA
GTGAGAGTACGCCCATCCTCGAGCTGCTTTCCGGCAAATATCAACCTTTGCTGATCTGGGGGAATTCCCTCCTTGTCCTGGATTTTAGCCTTGACATTGT
CGATCGTGTCTGAGCTTTCGACCTCGAGGGTAATGGTCTTTCCTGTCAGGGTCTTGACGAAAATCTGCATACCACCGCGGAGACGGAGAACCAGGTGTAG
TGTTGACTCCTTTTGGATGTTGTAGTCGGCAAGAGTACGACCGTCCTCGAGTTGTTTTCCAGCAAAAATGAGCCTCTGCTGGTCTGGTGGGATGCCCTCC
TTGTCCTGGATCTTAGCCTTGACATTATCGATCGTGTCTGAGCTTTCGACCTCGAGGGTAATGGTCTTTCCTGTCAGGGTCTTGACGAATATCTGCATAC
CACCACGGAGGCGGAGGACCAAGTGGAGGGTCGACTCTTTTTGGATGTTGTA